SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010464 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010464
Domain Number 1 Region: 6-94
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.42e-31
Family Ubiquitin-related 0.00000535
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010464   Gene: ENSTGUG00000010141   Transcript: ENSTGUT00000010574
Sequence length 97
Comment pep:known_by_projection chromosome:taeGut3.2.4:7:21763276:21773189:1 gene:ENSTGUG00000010141 transcript:ENSTGUT00000010574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EAKPSAEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRF
LFEGQRITDNHTPKELGMEEEDVIEVYQEQTGGHSTV
Download sequence
Identical sequences H0ZIP7
59729.ENSTGUP00000010464 ENSTGUP00000010464 ENSTGUP00000010464 XP_008936688.1.37566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]