SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010556 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000010556
Domain Number - Region: 144-166
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0251
Family EGF-type module 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010556   Gene: ENSTGUG00000010235   Transcript: ENSTGUT00000010667
Sequence length 479
Comment pep:known_by_projection chromosome:taeGut3.2.4:1A:50250032:50251603:-1 gene:ENSTGUG00000010235 transcript:ENSTGUT00000010667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMRRHKLFLTLCMAGLCLISFLHFLKALSYVTFPRELASLSPNLVSSFFWNNAPVTPQV
SPEPGPLSPSRASEELHKVEFVLPEDSTEYFVRTKAGGICFKPGTKVLEKPPVGGRQEER
VDGAASGRPARKPLSSSGAKRRKWVECVCLPGWHGPSCGVPTVVQYSNLPTKDRLVPREI
PRRVINAINVNHEFDLLDVRFHELGDVVDAFVVCESNFTAYGEPRPLKFREMLLNGSFDY
IRHKVLYVFLDHFPPGGRQDGWIADDYLRTFLTRDGISRLRNLRPDDVFIIDDADEIPAR
DGVLFLKLYDGWTEPFAFHMRKSLYGFFWKQPGTLEVVSGCTMGMLQAVYATDGIRLRRR
EYYTMPGFRQYENSTGHILVQWSLGSPLHFAGWHCSWCFTPEGIYFKLVSAQNGDFPRWG
DYEDKRDLNYIRELIRTGGWFDGTMQEYPPADPKEQMYAPKYLLKNYQRFRYLLENPYR
Download sequence
Identical sequences H0ZIY8
ENSTGUP00000010556 ENSTGUP00000010556 59729.ENSTGUP00000010556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]