SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010571 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010571
Domain Number 1 Region: 100-476
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.87e-91
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00000000000306
Further Details:      
 
Domain Number 2 Region: 4-90
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.21e-23
Family Ubiquitin-related 0.000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010571   Gene: ENSTGUG00000010223   Transcript: ENSTGUT00000010682
Sequence length 490
Comment pep:known_by_projection chromosome:taeGut3.2.4:2:107764543:107780891:-1 gene:ENSTGUG00000010223 transcript:ENSTGUT00000010682 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSAVNVKWGKEKFDGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGNLK
IKNGMTLLMMGSADALPEEPIARPIFVEDMTEEQLASAMELPCGLTNLGNTCYMNATVQC
IRSVPEVKEALKRYGGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMA
FPQFAEKGDQGQYLQQDANECWVQMMRVLQQKLEGIEGDTIMETDSGATAASSKKKSLID
QFFSIEFETAMKCTEAEEEEVTKGKENLLQLSCFINQEVKYLFTGLKLRLQEEITKLSPT
LQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDVYELCTPDLQ
EKMVSYRSKFKDLEDKKVNQQPKNSSKSDGAQKEVKYEPFSFPDDIGSNNCGYYDLQAVL
THQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRR
IEVVEEAAEQ
Download sequence
Identical sequences H0ZJ03
ENSTGUP00000010571 59729.ENSTGUP00000010571 ENSTGUP00000010571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]