SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010581 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010581
Domain Number 1 Region: 303-404
Classification Level Classification E-value
Superfamily ARID-like 6.54e-33
Family ARID domain 0.0004
Further Details:      
 
Domain Number 2 Region: 553-670
Classification Level Classification E-value
Superfamily Chromo domain-like 6.78e-21
Family Chromo barrel domain 0.011
Further Details:      
 
Domain Number 3 Region: 59-113
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000000374
Family Tudor domain 0.017
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000010581
Domain Number - Region: 191-291
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0014
Family Tudor domain 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010581   Gene: ENSTGUG00000010246   Transcript: ENSTGUT00000010692
Sequence length 1304
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:44707898:44762915:-1 gene:ENSTGUG00000010246 transcript:ENSTGUT00000010692 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQAIDEPPYLTVGTDVSAKYRGAFCEAKIKTAKRLVKVKVTFRHDSSTVEVQDDHIKGPL
KVGTVVEVKNPDGTYQEAVINKLTDASWYTVVFDDGDEKTLRRSSLCLKGERHFAESETL
DQLPLTNPEHFGTPVIGKKTNRGRRSNHIPEEESSSSSSDEDEDDRKQSDELLGKVVCVD
CFSVDKKKALWFPALVVCPDCSDDIAVKKDNILVRSFKDGKFVSVPRKDVREISETSPKP
DALLKQAFDQALEFRKNRTVPSNWKTELKEDSSSSEAEEEEEDEKEKEDNSSEEEASEEI
EPFPEERENFLQQLYKFMEDRGTPINKRPVLGYRNLNLFKLFRLVHKLGGFDNIESGAVW
KQVYQDLGIPVLNSAAGYNVKCAYRKYLYGFEEYCTSANIEFQMALPEKVTNKPCKDCEK
EKELKMREEPEQDAKEIKQEEVAVVQQEEKKSAENDNESKENDKPSVLGNKKNLPDSVFT
QPDQDKDLNLIKSEDETKLEDKEEEKIKEMENPTVNADAEEKEKLGDDTNKEEDEDEEEA
EEEEEEEEEEDNNNNEEEEFECYPPGMKVQVRYGRGKNQKMYEASIKDSDIEGGEVLYLV
HYCGWNVRYDEWIKADKIVRPADKNVPKIKHRKKIKNKTDREKEEKYSPKPCKLRRLSKP
PFHTSTSPESGSKLDSTEAKNTEQGPVKSIEITSIINGLQASESSDDSEQEDDQSAPNVH
ADGKEESQPEAVSQDKNELRLKEQSGSSLPEETKALTDAVVPKSVSKSPERLRKEMEELS
EDSDSDGEDEATKKRKDGKKEVVDKTAKPQVKRGKRRHCVAEESLKTVSPNRKDEKSKNK
DSLSLENSSNSSSDEDEEDKSKLKITPTKKYNGLEEKRKSLRTSTFYSGFSEVGEKRIKL
LNNSDERLQNTRAKDRKDVWSSIQGQWPKKTLKELFSDSDTEAAASPPHAAPEDAAAEEQ
LQTLAEEGISLPNCELEKSLSASVDVKPVEEKPTEVGEKKVEFPSSGSNSVLNTPPTTPE
SPSSVTVTESSRHQSSVTVSETLPPNQEEIRSIKSETDSTIEVDSVAGELQDLQSEGNIS
PTGFDASVSSSSSNQPEPEHTEKVCTGQKRLKDAQGGGSSSKKQKRSHKTSVSNKKKSKT
TNSSDSDELSAGESVSKSQSAKSVSTGMKSHQTKSLTRTQSPGKCGKNGEKESDLKEQNN
RLPKVYKWSFQMSDLENLTSAERITVLQEKLQEIRKHYLSLKSEVASIDRRRKRLKKKER
ESAATTSSSSSSPSSSSITAAVMLTLAEPSMSSSSQNGMSVECR
Download sequence
Identical sequences H0ZJ13
59729.ENSTGUP00000010581 ENSTGUP00000010581 ENSTGUP00000010581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]