SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010582 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010582
Domain Number 1 Region: 129-328
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.75e-54
Family Prokaryotic proteases 0.000000484
Further Details:      
 
Domain Number 2 Region: 344-438
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-19
Family HtrA-like serine proteases 0.0014
Further Details:      
 
Domain Number 3 Region: 3-80
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000581
Family Growth factor receptor domain 0.0015
Further Details:      
 
Domain Number 4 Region: 67-112
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000162
Family Ovomucoid domain III-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010582   Gene: ENSTGUG00000010252   Transcript: ENSTGUT00000010693
Sequence length 439
Comment pep:novel chromosome:taeGut3.2.4:4:60577577:60600918:1 gene:ENSTGUG00000010252 transcript:ENSTGUT00000010693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AKCPARCDVSTCPSPSCPSGYVPDRCGCCLICAAGEGDSCGRKEDPPCGDSLDCRYPMGK
RFAKGVCQCKLSAQVCGSDGRTYDNICQLKAVSRKALQHGLPAVAQVQKGACESGRSMSS
SPRYKFNFIADVVEKIAPAVVHIELFLRHPLFGRNVPLSSGSGFIMSDSGLIVTNAHVVS
STNAISGRQQLKVQLQNGDTYEATIKDIDKKSDIATIKIHPKKKLPVLLLGHSADLRPGE
FVVAIGSPFALQNTVTTGIVSTAQRDGKELGLRDSDMDYIQTDAIINYGNSGGPLVNLDG
EVIGINTLKVTAGISFAIPSDRITQFLTESHDKQSKGKTDGKKRFIGIRMLTITPALVEE
LKHSNADFPDVRSGIYVHEVVPNSPSHRGGIQDGDIIVKVNGRPLLTSSDLQEAVMNESP
LLLEVRRGNDDLLFNIEPE
Download sequence
Identical sequences H0ZJ14
ENSTGUP00000010582 59729.ENSTGUP00000010582 ENSTGUP00000010582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]