SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010594 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010594
Domain Number 1 Region: 1-48
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00000000000000275
Family Chromo domain 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000010594
Domain Number - Region: 193-220
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0398
Family Fibronectin type III 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010594   Gene: ENSTGUG00000010271   Transcript: ENSTGUT00000010705
Sequence length 234
Comment pep:novel chromosome:taeGut3.2.4:1A:50422666:50431866:1 gene:ENSTGUG00000010271 transcript:ENSTGUT00000010705 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEDHILDPRLVVAYEEKEERDRASGYRKRG
PKPKRLLLQRLYGMDLRSAHKGKEKLCFSLARRFGGGDSSLPGAKTGQAEFPEKTGGAVL
PFSLRKQRKNQKYLRLSRKKFPRMASLENRNCRHEFFLNDAVGLEARQSPEDWEAMQHTS
KEVQADFTYGFLPWIPTVPPSEVTVTDITANSITVTFREAQVAEGFFRDRSAQF
Download sequence
Identical sequences H0ZJ26
ENSTGUP00000010594 59729.ENSTGUP00000010594 ENSTGUP00000010594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]