SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010598 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010598
Domain Number 1 Region: 80-130
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000377
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Domain Number 2 Region: 212-287
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000465
Family APG12-like 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010598   Gene: ENSTGUG00000010273   Transcript: ENSTGUT00000010709
Sequence length 294
Comment pep:known_by_projection chromosome:taeGut3.2.4:6:23155030:23173013:-1 gene:ENSTGUG00000010273 transcript:ENSTGUT00000010709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAPSCSGSRSHPFEFERGRSESSGDEDDDDEDDEEEEVEEEEEEMEGDSRARFGADDGEL
DSDDDRERMINLAELTPYILCSICKGYFIDATTITECLHTFCKSCIVRHFYYSNRCPKCN
IVVHQTQPLYNIRLDRQLQDIVYKLVVNLEEREKKQMHDFYKERGLEVPKPAVPQPVPPS
RGRPRKVLGSVFRIPPELDISILLEFIGANEGAGNFKPLEKKFVRVSGEATIGHVEKFLR
RKMDLDPACQVDIICGDHLLEHYQTLREIRQVIGESAVQDGLLVLHYGLVVSPL
Download sequence
Identical sequences H0ZJ30
ENSTGUP00000010598 ENSTGUP00000010598 59729.ENSTGUP00000010598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]