SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010600 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010600
Domain Number 1 Region: 8-143
Classification Level Classification E-value
Superfamily Cap-Gly domain 2.09e-34
Family Cap-Gly domain 0.00059
Further Details:      
 
Domain Number 2 Region: 126-370
Classification Level Classification E-value
Superfamily L domain-like 6.12e-27
Family Internalin LRR domain 0.023
Further Details:      
 
Domain Number 3 Region: 443-529
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.28e-22
Family Ubiquitin-related 0.0000505
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010600   Gene: ENSTGUG00000010264   Transcript: ENSTGUT00000010711
Sequence length 529
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:44819883:44843976:1 gene:ENSTGUG00000010264 transcript:ENSTGUT00000010711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVPPDALGRRVACGTDYGTVRYVGSVSPTAGIWLGVEWDDPQRGKHDGSYEGTQYFK
CRHPKGGSFIRPNKANFGVDFLTAVKDRYGLNDKQDALCGTGDTVVFGTKTVEFVGMDSV
AEQQRQLNKLVDISVRECAVSHAGQEEEISRTCVNMRHINLSKNLISSWETVIAIASQVQ
NLETLNVSENKMRFPSTSTFTSSAFSNLKILALNQTEITWTEVLLCAQGWPVLEELYLSS
NNITVLERPDNVLQTLKLLDLSDNQLLDGNQLHLIAHLPRLEQLILRNTGISSIYFPDAG
FGCKTKMFPSLKRLAINENKISQWSSINELDKLPSLRALQCNNNPIMDTEKNPETLIQLI
IAKISQLEVLNNCEILPAERRGAELDYRKIFGKDWLEAGGHWNPEKNKPSEEFLAAHPRY
PILCLKYGAPEEGELKRQQPLTLKNQLLTLTIKCPEKPEQKPVEKKLPESMTIQKVKGLL
YRLFKIPGSDLKLSYKSSKLEGKEVELDNDLKPLQFYSIESGDCVLVRW
Download sequence
Identical sequences H0ZJ32
XP_002192215.1.42559 ENSTGUP00000010600 59729.ENSTGUP00000010600 ENSTGUP00000010600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]