SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010616 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010616
Domain Number 1 Region: 236-433
Classification Level Classification E-value
Superfamily MIR domain 1.48e-66
Family MIR domain 0.00000000906
Further Details:      
 
Domain Number 2 Region: 435-600
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 1.83e-59
Family IP3 receptor type 1 binding core, domain 2 0.0000000215
Further Details:      
 
Domain Number 3 Region: 1153-1276
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 1.83e-34
Family IP3 receptor type 1 binding core, domain 2 0.0074
Further Details:      
 
Domain Number 4 Region: 108-219
Classification Level Classification E-value
Superfamily MIR domain 9.42e-20
Family MIR domain 0.015
Further Details:      
 
Domain Number 5 Region: 1228-1318,1414-1500,1529-1682,1959-2068
Classification Level Classification E-value
Superfamily ARM repeat 0.0000108
Family HspBP1 domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010616   Gene: ENSTGUG00000010241   Transcript: ENSTGUT00000010728
Sequence length 2746
Comment pep:known_by_projection chromosome:taeGut3.2.4:12:20139304:20284697:1 gene:ENSTGUG00000010241 transcript:ENSTGUT00000010728 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPEAGDLNNPPKKFRDCLFKL
CPMNRYSAQKQFWKAAKPGANSTTDAVLLNKLHHAADLEKKQNETENRKLLGTVIQYGNV
IQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDEAGNEGSWFYIQPFYKLRSIGDSVVIGD
KVVLNPVNAGQPLHASSHQLVDNPGCNEVNSVNCNTSWKIVLFMKWSDNKDDILKGGDVV
RLFHAEQEKFLTCDEHRKKQHVFLRTTGRQSATSATSSKALWEVEVVQHDPCRGGAGYWN
SLFRFKHLATGHYLAAEVNPDYEEDDLECQSSLDPEQEARRGRGPQEKMAYSLVSVPEGN
DISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVHSTNIPIDKEEEKPVMLKIGTSP
VKEDKEAFAIVPVSPAEVRDLDFANDASKVLGSIAGKLEKGTITQNERRSVTKLLEDLVY
FVTGGTNSGQDVLEVVFSKPNRERQKLMREQNILKQIFKLLQAPFTDSGDGPMLRLEELG
DQRHAPFRHICRLCYRVLRHSQQDYRKNQEYIAKQFGFMQKQIGYDVLAEDTITALLHNN
RKLLEKHITAAEIDTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICKAVLNPANA
DILIETKLVLSRFEFEEVSSGENALEVGEDEEEVWLFWRDSNKEIRSKSIRELAQDAKEG
QKEDRDVLSYYSSELSRAAWVSWGGKLLFQAQNSLQRGRVKSLRRAESTKLFVVRSPGID
MSQCKLIFKEYPVYLHAKFCFVFFSVLFFFFPLFSYDSSGTSKDEIKERFAQTMEFVEEY
LRDVVCQRFPFSDKEKNKLTFEVVNLARNLIYFGFYNFCDLLRLTKILLAILDCVHITTI
FPITKMAKGEESKGSNVMRSIHGVGELMTQVVLRGGGFLPMTPLAAAPEGNVKQSEPEKE
DILVMDTKLKIIEILQFILNVRLDYRISCLLCIFKHEFDESNAQMSESPTGSSSQEMPAN
VPGALDFEHIEEQAEGIFGGRKENTPLDLDDHGGRTFLRVLLHLTMHDYPPLVSGALQLL
FRHFSQRQEVLQAFKQVPVWIASEAGRMPVADQVLPTFPDSSPMTELWVYKGQGPDEAMD
SVPGENEHKKKEEGHSKSQKPESTSSYNYRVVKEILLRLSKLCVQEGASVRKSRKQQQRL
LRNMGAHAVVLELLQIPYEKAEDTRMQEIMKLAHEFLQNFCAGNQQNQALLHKHINLFLN
PGILEAVTMQHIFMNNFQLCSEINERVVQHFVHCIETHGRNVQYIKFLQTIVKAEGKFIK
KCQDMVMAELVNAGEDVLVFYNDRASFQTLVQMMRSERDRMDENSPLMYHIHLVELLAVC
TEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYINFLNHCYVDTEVEMKEIYTSN
HMWKLFENFLVDICRACNNTSDRKHADSILEKYVTEIVMSIVTTFFSSPFSDQSTTLQTR
QPVFVQLLQGVFRVYHCTWLMPSQKASVESCIRVLSDVAKSRAIAIPVDLDSQVNNLFLK
SHNIVQKTAMNWRMTARNAARRDSVLAASRDYRNIIERLQDIVSALEDRLRPLVQAELSV
LVDVLHRPELLFPENTDARRKCESGGFICKLIKHTKQLLEENEEKLCIKVLQTLREMMTK
DRGYGEKSVNSNYSHNSFLPQAPETESPVEQELDQTLPQRQLEDHRRGEALRQVLVNRYY
GNVRAAGRRESLTAFGNGPLSAGSPGKAGPGGGSSGSSSMSRGEMSLADVQCHLDKEGAS
NLVIDLIMNATSDRVFHESILLAIALLEGGNTTIQHSFFCRLTEDKKSEKFFKVFYDRMK
VAQQEIKATVTVNTSDLGNKKKDEDSDRDVPNRKRVREPMSQITEEVRDQLLEASAATRK
AYNAYRREADPEEHYSAGEGAQAAADKSKDELEMSAVISIMQPILRFLQLLCENHNRDLQ
NFLRCQNNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINEKNVALINQTLESLTEYCQ
GPCHENQNCIATHESNGIDIITALILNDINPLGKKRMDLVLELKAMNNASKLLLAIMESR
HDSENAERILYNMRPKELVEVIKKAYLQGEVEFEDGENGEDVAASPRNVGHNIYILAHQL
ARHNKELQNMLKPGGQIEGDEALEFYAKHTAQIEIVRSDRTMEQIVFPVPSICEFLTKES
KLRIYYTTERDEQGSKINDFFLKSEDLFNEMNWQKKLRAQPFLYWCARNMSFWSSISFNL
AVLMNLLVAFFYPFKGIRGGTLEPHLSGLLWTAMLISLAIVIALPKPHGIRALIASTILR
LIFSVGLQPTLFLLGAFNVCNKIIFLMSFVGNCGTFTRGYKAMIMDVEFLYHLLYLLICA
LGLFVHEFFYSLLLFDLVYREETLLNVIKSVTRNGRSIILTAVLALILVYLFSIVGYLFF
KDDFILEVDKLPNETLLPEPGETMTGEFLYSDVCKAGSSDNCSSIIPSDQLITEEMEEEN
KEHTCETLLMCIVTVLSHGLRSGGGVGDVLRKPSKEEPLFAARVIYDLLFFFMVIIIVLN
LIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVTFEEHIKEEHNMWHYLC
FIVLVKVKDSTEYTGPESYVAEMIKVKRNLDWFPRMRAMSLVSSDSEGEQELRILEKLES
TMKLVTLSGQLSELKDQMTEQRKQKQRIGLLGHPPPMNVNLQQQPA
Download sequence
Identical sequences H0ZJ48
ENSTGUP00000010616 ENSTGUP00000010616 59729.ENSTGUP00000010616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]