SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010630 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010630
Domain Number 1 Region: 91-284
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.42e-52
Family Astacin 0.0000496
Further Details:      
 
Domain Number 2 Region: 290-397
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-29
Family Spermadhesin, CUB domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010630   Gene: ENSTGUG00000010305   Transcript: ENSTGUT00000010742
Sequence length 408
Comment pep:novel chromosome:taeGut3.2.4:5:20831936:20841142:1 gene:ENSTGUG00000010305 transcript:ENSTGUT00000010742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELKRFLLCAALLLPAALGFPVQDNYENSTTSNTCCFLTVYYILESPSPTETDEEDEDIF
NKILKVNKDSSQFLQEGDIVPRRSRSAINCRHCNWPQSSDGIVRIPYELDPTYDESHVKG
IHDAMAEFEALTCINFVKRKAERDYLSIRSADGCWSNYGKVGGGQTVSVMKGGCMWKGVI
QHELEHALGFLHEHSRSDRDKHVKIMWEYISPPDRPDFKKFENSNNLDLPYDYTSVMHYG
PYTFTNTTGKATIIPIPDGSVHIGQRQGMSNLDVAKINKLYNCSRCSTILDGPSGSLRSA
NYPRNYSDNTNCVWLIRTRARKVSLYFQAFQLQKTRGCQGDYVKVYDGSSKSSPVLMDKT
CGSQIPNGVVASSNLMLVEFITDGAHTASGFQATFTAGKSENKENKEN
Download sequence
Identical sequences H0ZJ62
ENSTGUP00000010630 ENSTGUP00000010630 59729.ENSTGUP00000010630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]