SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010631 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010631
Domain Number 1 Region: 86-279
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.32e-52
Family Astacin 0.0000496
Further Details:      
 
Domain Number 2 Region: 285-392
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-29
Family Spermadhesin, CUB domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010631   Gene: ENSTGUG00000010305   Transcript: ENSTGUT00000010743
Sequence length 398
Comment pep:novel chromosome:taeGut3.2.4:5:20831954:20841127:1 gene:ENSTGUG00000010305 transcript:ENSTGUT00000010743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLCAALLLPAALGFPVQDNYENSTTNVLFLQVTTEENIYESPSPTETDEEDEDIFNKILK
VNKDSSQFLQEGDIVPRRSRSAINCRHCNWPQSSDGIVRIPYELDPTYDESHVKGIHDAM
AEFEALTCINFVKRKAERDYLSIRSADGCWSNYGKVGGGQTVSVMKGGCMWKGVIQHELE
HALGFLHEHSRSDRDKHVKIMWEYISPPDRPDFKKFENSNNLDLPYDYTSVMHYGPYTFT
NTTGKATIIPIPDGSVHIGQRQGMSNLDVAKINKLYNCSRCSTILDGPSGSLRSANYPRN
YSDNTNCVWLIRTRARKVSLYFQAFQLQKTRGCQGDYVKVYDGSSKSSPVLMDKTCGSQI
PNGVVASSNLMLVEFITDGAHTASGFQATFTAGKSENK
Download sequence
Identical sequences H0ZJ63
ENSTGUP00000010631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]