SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010650 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010650
Domain Number 1 Region: 81-355
Classification Level Classification E-value
Superfamily L domain-like 1.7e-60
Family Leucine rich effector protein YopM 0.027
Further Details:      
 
Domain Number 2 Region: 402-582
Classification Level Classification E-value
Superfamily L domain-like 9.52e-31
Family Ngr ectodomain-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010650   Gene: ENSTGUG00000010302   Transcript: ENSTGUT00000010762
Sequence length 606
Comment pep:known_by_projection chromosome:taeGut3.2.4:8:27046752:27058658:1 gene:ENSTGUG00000010302 transcript:ENSTGUT00000010762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAARRARAVGVGAVAARGQGSEGEEPAVPQGRVLRLARRSGQLNLAGRGLTHVPEHVWR
INLDTPEEAQQNLSFGAADRWWEQTDLTKLILASNKLQSLSEDVQLLPALTVLDVHDNQL
TSLPSALGQLENLQKLDVSHNKLRSLPEELLQLPHLRSLLVQHNELSQLPEGLGQLLSLE
ELDVSNNQLTAIPTSFALLVNLVRLNLACNQLKELPADLSAMKSLRQLDCTKNYLETVPP
KLATMASLEQLYLRKNKLRSLPELPSCKLLKELHAGENQIEILNAENLKQLSSLCVLELR
DNKIKAVPEEITVLQKLERLDLANNDISRLPYTLGNLSQLKFLALEGNPLRTVRRDLLQK
GTQELLKYLRSKIQDDGPGPSEEPPVTAMTLPSQSKVNIHAITTLKLLEYSDKQAAEIPE
AVFDAVGANPVATVNFSKNQLREIPPRLVELKDSVCDVSLGFNKISCISSGLCLLQKLTH
LDLRNNVLTALPEEMEALKRLHTINLAFNRFKVFPSVLYRLPALETILLSNNQVGSIDPV
QLKGLDKLGTLDLQNNDLLQVPPELGNCENLRSLLLEGNPFRTPRAAVLAKGTAAVLEYL
RSRIPS
Download sequence
Identical sequences H0ZJ82
ENSTGUP00000010650 59729.ENSTGUP00000010650 ENSTGUP00000010650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]