SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010655 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010655
Domain Number 1 Region: 2032-2131
Classification Level Classification E-value
Superfamily BEACH domain 1.83e-32
Family BEACH domain 0.00031
Further Details:      
 
Domain Number 2 Region: 1934-2036
Classification Level Classification E-value
Superfamily PH domain-like 1.17e-22
Family PreBEACH PH-like domain 0.011
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000010655
Domain Number - Region: 465-611
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0117
Family Pentraxin (pentaxin) 0.064
Further Details:      
 
Domain Number - Region: 1231-1321,1356-1429,1468-1488,1606-1767
Classification Level Classification E-value
Superfamily ARM repeat 0.0512
Family Plakophilin 1 helical region 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010655   Gene: ENSTGUG00000010290   Transcript: ENSTGUT00000010767
Sequence length 2134
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:44916443:44953928:-1 gene:ENSTGUG00000010290 transcript:ENSTGUT00000010767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EGVTTSAREETEWALQGIRLLEALLTICLHSASTMQQKTEVEMFHQNTSVDDILLEIREQ
LAQSKVIETDLAKPLFDSLLRVALGTFSADLDHSEEKIEKTHYAEKEPVSQPGEISEETE
ESQCCSLKLFAEEEGYEADSESNPDDSETKNEGADTKVESGCTGASGYFNGLAENINQGE
LMYPEICMLELNLLSAGNASLDVLAHVFQSCLNIINQKERNATVLIEQQGAVKHLLGGFL
NILTQTESSFHACQVVLVDLLVSLMSSQTCSEELTLLLRVFLEKTPCTEVLLKGVLKIVD
TNIYMNPLQYLAFPLLNGTNLSSSSSQKCAGTSNNKNAGLLKRGKLSQSKKEADGENLSH
QLLSSWHVAPIHLPLVGQNCWPHMSDGFSFSMWFRLEYAHEAENSAEKGKKVKRRSRLIA
VRENSFDSTEETKSIGMEYVSLGDKLVEDGCIHIISLGSKALMIQVWADLNTGAFIFRMC
MDPNDEMKAGLLAQAESPGNVFLVGRWQHLALKYLQKPEGKKNFRGKLLLWVSGQRQCEI
NLDFALPRKTSLSSDSNKTFCMIGHCTSSQEDLLRLSGRWDLGNLLLFNGANIGPEEAFY
LYTCGPDFTSVMPCKYGKILTDCSKYISKEILQCEQIKELFMTKKEVDVGPLIESLAVVY
TTSCPGQYTIYEPVIRLKGQAKTVPSQRPFSLKEVQSNVLDSQHLKALQPVEYKTLQSIL
HEIGGTGAFVFLFARVVEISSCEDTQALALQLTLSLTKYNQQRIQEMDNCNGYSMIRRVL
IKQKCIVGFCMLKTLLEGCCSDEILYVNENGQFQLDPDSTAVIQDVQLLEKLLLDWKIWS
KAKQGVWETLLAALEILIRANHHQQMFNIKQLLKAQVVHHFLLTCQVLQEHKEGHLASLP
QEVCRSFVKIIEEVLGSPPDLELLTLVFNFLLAVHPPTNTYVCHNPTNFYFSLHIDGKIF
QEKVESLRYLRNSSSGGKSVDNSAFMITSPTGFTALPLEGSTSKADVQQKISCQAPRRLS
KSLPASPISSPQVHRKGLTERMGSSVDDLQILGERNYIDLQGRIDFVESSESIKRVQEEL
FLSSCESAKTVCDTELTSAETLPLLQYPQMLSTESALESKEADTGLKCSEAAGGAGGAEA
SLRRPDNLKGLPSFQKGQSNFAGLGLAFSVLGASSAIARWPSFADKNVIPEDWDSLAFSS
PNENTPKPSESPDDRCAEDYLVLICCGLYDLLRGVLLILPDIMLEDVMDKLIQPDYLIVL
VNHPSPLIQQGVIKLLDAYFNRAKREQKEKFLKNRGFSLLANQLYLHQGTQEVVECFLEM
LFGRSVGLDEEFDLEDVKNVGLFRKWCVIPVLGLIENSLYDNVLLHNCFCLLLQIINSCS
KVADLLLDNGLLYVLCNTLAALNGLETNIPLNDYKLLACDIQQLLVAVAIHACSSSGSQY
FRVIEDLIVLLGHLQNSKNARMQNMAVVLQLRVLQAAIELIKTTTSQDAQEQASSAPAPS
APHRAMFQKRKGMAGSRKFSLAQSDALLVKMRSLASEEFNMMMQRRMSQENPIQATESEF
AQRLQRLTVLAVNRLIYLASTEECLDVLGITENTSQSRLSASQLEVPEEESQQELTSRIN
PFLKEMVKMLVEGIKVSIGTSRMSTPKQQWNRILLLCKDTFRTQLGRLLVHSLSPLSPLQ
ERKQALEMAHEVNQQEILRDCLSPTLQHGPKLVLYLYELMHSHSDGMTKEQQRAAGDLMN
TLKSCGYKCIPLSPRPKPDLIKALKEDQKKYEMEEGVNKAAWEKTMANNRQNLFQRLDTK
SKDISKIAGDITQAVSLSQGMERKKVIQHIRGMYKAELSASRHWQELVQQLTHDRALWYD
PVYYPTSWQLDPTEGPNRERRRLQRCYLTIPNKYLLPDRQKQEGVIKTPLSYLFEDKTHS
SHSSTVKDKAASEHIRVNRRCVSVAPSRETAGELLLGKCGMYFVEDNASDTIENSSFHGE
TEPASFSWTYEEIKEVHKRWWQLRDNAVEIFLTNGRTLLLAFDNTKVRDDVYHNILTNNL
PNLLEYGNITALTHLWCTGQITNFEYLTHLNKHAGRSFNDLMQYPVFPFILSDYTNETLD
LNDPSVYRNLVKPIAVQSKEKEDRYVDTYKVIWI
Download sequence
Identical sequences H0ZJ87
59729.ENSTGUP00000010655 ENSTGUP00000010655 ENSTGUP00000010655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]