SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010683 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010683
Domain Number 1 Region: 1-243
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.5e-67
Family Eukaryotic proteases 0.0000684
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010683   Gene: ENSTGUG00000010360   Transcript: ENSTGUT00000010796
Sequence length 245
Comment pep:known_by_projection chromosome:taeGut3.2.4:4:61720316:61732433:-1 gene:ENSTGUG00000010360 transcript:ENSTGUT00000010796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RIVGGSSSLPGSHPWTAAIYIGESFCGGSLVQTCWVVSAAHCFANSPLKSTIRVVLGQQI
FNKTTDVTQTFEIEKYILHPQYSVFNPTEHDIALIKLKKNGQRCAVKSQFVQPICLPESN
TVFPDQLKCQISGWGHKHENISGYSDVLQETLVPLIPEEKCRRPEIYGTELTENMFCAGY
FDSKSDAYPGLLGGLHLCLDLTPGQQLYILERLHFWGDGCGRANRPGVYTRVTNYVKWIN
EKIAP
Download sequence
Identical sequences H0ZJB5
59729.ENSTGUP00000010683 ENSTGUP00000010683 ENSTGUP00000010683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]