SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010696 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010696
Domain Number 1 Region: 397-628
Classification Level Classification E-value
Superfamily GFP-like 2.2e-90
Family Domain G2 of nidogen-1 0.00000000615
Further Details:      
 
Domain Number 2 Region: 909-1144
Classification Level Classification E-value
Superfamily YWTD domain 7.06e-50
Family YWTD domain 0.00000000287
Further Details:      
 
Domain Number 3 Region: 777-885
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 3.53e-23
Family Thyroglobulin type-1 domain 0.0004
Further Details:      
 
Domain Number 4 Region: 354-394,639-734
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.95e-19
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 5 Region: 727-808,843-856,1166-1210
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000033
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010696   Gene: ENSTGUG00000010336   Transcript: ENSTGUT00000010809
Sequence length 1213
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:45035839:45078169:-1 gene:ENSTGUG00000010336 transcript:ENSTGUT00000010809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLPHGEDRGDAALEPGDDVYSAALELSTALRFYGAAVRSLYVTTNGIIAVNEPSSEKKYL
GQFPVMSFGAIAPFMADLDTTDGRGNVYYREDSSSDVLQLASEYIKSGFPETAFDPSSVV
IVTWKLVAPFQALGEDHALEEKRNTFQAVLASSDSSSYAIFLYPEDSLQFCSTYSKNGNE
NIPAMVGFSQASTNYYFWEKPGSYNIIANDEDSIRNLYKSSNAGKQGVWVFEIGSSSDSI
VPAKINNILESIEPSEEDQEMTSKPFISTDSTEEDQHLVTYSVPQLAAEDFPTSYQDVTG
TPSTESFYSPQNFPTAKAPPRQFRIQQFPPQPPQVIDVEEFDETGIVFRYHTDVQETCAN
NRHQCSVHAICKDYPNGFCCSCIAGYKGNGRQCVAEGSPQRVNGKVRGRIFVGNNPVPVV
FENTDLHSYVVMNQGRAYTAISTIPETLGYSLLPLASIGGIIGWMFAVEQQGYRNGFSIT
GGEFTRQTEVTFLGNNEKLVVKQKFSGIDEHGHLTISTEMEGRIPEIPSGASVHIEPYTE
LYHTSSSVITSSSSREYTVTEPERDGGTSTYTGAYQWRQTISFDECIHDDSPHSAPATQQ
LSVDSVFVLYNRDEQILRYAMSNSIGPISDGSADINRNPCYTGTHNCDTNAVCRPGTGNR
FFCECSIGFRGDGNICYDIDECSEQPGLCGSNADCNNQPGTYRCECVGGYQFAADGRTCV
AVEHEVNHCQRGTHSCDIPQRAQCVYTGGSAYICTCLPGFSGDGRACEDVDECQQGHCHP
DAFCYNTPGSFSCHCKAGYRGDGFRCVLGEAEKTKCQHEREAAFGSGGAFFPRGVRAGHF
IPQCDEHGNYLPTQCHAGSGYCWCVDRDGNEIDGTRSGPGVRPPCLSTAAPPVVVGPSVR
PDTVPLPPGTHLLFAQSGKIEHVPLEGNNMKKNGAKALLHIPDKVVIGVAYDCVDKMVYW
TDISGPSISRASLHGGEPTTIIKTDLGSPEGIAVDHLGRNIFWTDSQLDRIEVARLDGRQ
RRILFDTGLVNPRAIVVDPVRGNLYWTDWNREAPKIETSYMDGTNRRILVKDDLGLPNGL
TFDPYSSMLCWVDAGTKRLECMNPNQLGRRKIIEGIQYPFGVTSYGKNLYYTDWRRDAVV
AVDRTISLENDNFQPHKRSRLYGITTAFAQCPGGHNYCTVNNGGCTHLCLATPGGRTCRC
PDNTVGVDCIERN
Download sequence
Identical sequences H0ZJC8
ENSTGUP00000010696 ENSTGUP00000010696 59729.ENSTGUP00000010696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]