SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010725 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010725
Domain Number 1 Region: 10-151
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.61e-45
Family Galectin (animal S-lectin) 0.0000872
Further Details:      
 
Domain Number 2 Region: 181-312
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.19e-42
Family Galectin (animal S-lectin) 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010725   Gene: ENSTGUG00000010394   Transcript: ENSTGUT00000010838
Sequence length 314
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:45194389:45206325:1 gene:ENSTGUG00000010394 transcript:ENSTGUT00000010838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPLDTSQKTISNPIIPYVGTIHGGLVPGELIVIHGTVPDDADRFQVDLQCGSSIKPRADV
AFHFNPRFKRSGCIVCNTLEREKWGWEEITYEMPFGKGKSFEIVIMILKDKFQVTVNKKH
LLLYNHRISLEKIDTLGIYGKVQIKTIEFVSKSLQGSQPSSLGVTKINTENGAMPNGSQL
GVPYTGKLDTALRPGCTIAIKGEVNKNPKSFAINLRPSDSKDIALHLNPRMKNKVFVRNS
YLHDSWGEEEKEITNFPFSPGMYFELIIFCDAYQFKVAVNGVHTLEYKHRFKQLEKISIV
EVTGDVHLLDVRSW
Download sequence
Identical sequences H0ZJF7
ENSTGUP00000010725 59729.ENSTGUP00000010725 ENSTGUP00000010725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]