SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010755 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010755
Domain Number 1 Region: 600-898
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.7e-78
Family Protein kinases, catalytic subunit 0.000000000355
Further Details:      
 
Domain Number 2 Region: 11-181
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.64e-72
Family Ephrin receptor ligand binding domain 0.000000281
Further Details:      
 
Domain Number 3 Region: 310-515
Classification Level Classification E-value
Superfamily Fibronectin type III 1.77e-41
Family Fibronectin type III 0.000082
Further Details:      
 
Domain Number 4 Region: 894-967
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.34e-22
Family SAM (sterile alpha motif) domain 0.00011
Further Details:      
 
Domain Number 5 Region: 236-307,358-363
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000177
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010755   Gene: ENSTGUG00000010386   Transcript: ENSTGUT00000010868
Sequence length 970
Comment pep:known_by_projection chromosome:taeGut3.2.4:9:18265790:18278878:-1 gene:ENSTGUG00000010386 transcript:ENSTGUT00000010868 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LILSLLPFSPETLMDTKWVTSELAWTTHPETGWEEVSGYDEAMNPIRTYQVCNVREANQN
NWLRTKFIQRQDVQRVYVELKFTVRDCNSIPNIPGSCKETFNLFYYESDTDSASANSPFW
MENPYIKVDTIAPDESFSKLESGRVNTKVRSFGPLSKNGFYLAFQDLGACMSLISVRAFY
KKCSNTIAGFAIFPETLTGAEPTSLVIAPGTCIPNAVEVSVPLKLYCNGDGEWMVPVGAC
TCAAGYEPAMKDTQCQACGPGTFKSKQGEGPCSPCPPNSRTTSGAAMVCTCRNGFFRADT
DPADSACTSVPSAPRNVISNVNETSLVLEWSEPQDTGGRDDLLYNVICKKCSVERRLCTR
CDDNVEFVPRQLGLTERRIYISNLMAHTQYTFEIQAVNGISNKSPYPPHFASVNITTNQA
APSAVPTMHLHSSTGNSMTLSWTPPERPNGIILDYEIKYSEKQGQSDGIANTVTSQKNSV
RLDGLKANARYMVQVRARTVAGYGRYSLPTEFQTTAEGGSTSKTFQELPLIVGSATAGLV
FVIVVVVIAIVCFRKQRNNTDPEYTEKLQQYGEFTPGMKVYIDPFTYEDPNEAVREFAKE
IDISCVKIEEVIGAGFGEVCRGRLKLPGRREIFVAIKTLKVGYTERQRRDFLSEASIMGQ
FDHPNIIHLEGVVTKSRPVMIITEFMENCALDSFLRLNDGQFTVIQLVGMMRGIAAGMKY
LSEMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDPADPTYTSSLGGKIPIRWTAPE
AIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVINAVEQDYRLPPPMDCPTALH
QLMLDCWVRDRNLRPKFAQIVNTLDKLIRNAASLKVIASVQSGISQPLLDRTVPDYTTFT
TVGDWLDAIKMGRYKENFVNAGFASFDLVAQMTAEDLLRIGVTLAGHQKKILSSIQDMRL
QMNQTLPVQV
Download sequence
Identical sequences H0ZJI7
ENSTGUP00000010755 59729.ENSTGUP00000010755 ENSTGUP00000010755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]