SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010837 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010837
Domain Number 1 Region: 41-235
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 3.28e-44
Family Noggin 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010837   Gene: ENSTGUG00000010509   Transcript: ENSTGUT00000010950
Sequence length 236
Comment pep:novel chromosome:taeGut3.2.4:1A:50874459:50875196:1 gene:ENSTGUG00000010509 transcript:ENSTGUT00000010950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLLLLCLLAPPAIPGPPPPPEEPGQPPRPPSGTADPAAHLLRGQPSAPARPYSLSLSPED
YRYAPKPRHLRPGRLRRLLGSAFDPFWMATEEPRRRNGSVLEESLESASRDLAEGAGRYH
RELWREAEGLELPPELAGALARRLRQWLVERATCRLTSAWVDLGPVFWPRWVRHTKCETG
PPGCSWPPGMSCRPAQLTRIKLLAWHCWTPPLPGPPSCTWRHIPYPVVAACKCSCR
Download sequence
Identical sequences H0ZJR8
ENSTGUP00000010837 59729.ENSTGUP00000010837 ENSTGUP00000010837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]