SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010840 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010840
Domain Number 1 Region: 460-518
Classification Level Classification E-value
Superfamily UBA-like 1.53e-19
Family CUE domain 0.00026
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000010840
Domain Number - Region: 178-210,239-360,468-524,600-614,648-660
Classification Level Classification E-value
Superfamily ARM repeat 0.000734
Family MIF4G domain-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010840   Gene: ENSTGUG00000010495   Transcript: ENSTGUT00000010953
Sequence length 745
Comment pep:novel chromosome:taeGut3.2.4:15:12853825:12875849:-1 gene:ENSTGUG00000010495 transcript:ENSTGUT00000010953 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPALPLDELQLTERDPKTGKLRTLPALHPEIKADRSFVLYKPPPAIRDPALVEEFLERAK
FIADDLNWLLALPHDKFWCQVIFDETLQKCLDSYLRSAPRKFDVLWDCHPEVHELQKCLH
RSVFLTFLRMSTHKESKDHFITPSVFGKIIYNNFLFDIPKILDLCVLFGKGNGLLLQKMI
GNIFTQQPSYFSDLDETLPTVLQVFNNILHKCGLQCEGASAEPQKLEEKVSVTAGNMPLQ
ELKDIVLYLCDTCTTLWAFLDVFPLACQTFQKHEFCYRLASFYELAIPELESAIKKRHYE
DNSVFADLWRRISHSRKKMIEVFHILVNRVCLQPILESSCENIQPFIEEFLQIFTSVLQE
RRFLRDYDELFPVEDDVSLLQQASSALDETRTAYILQAVESAWEGVDRRKGQVVKDPAAS
NGASAIVESTPEDREDPGAACALEDECAGAAAAPIACVSGVELDSLISQVKDLLPDLGEG
FILACLEEYGYNTEQVINNILEEKLVPYLDKLDRRMERQLKPDPTPLVSSRCNVFQNDEF
DVFSRDAVDVSRIQKGKREKDTTRSLVNDKRLVAEQRQRYSQYSVVLEELPLQPGAAQPF
EDYEDEYDDTYDGNQVGANDADSDDELISRRPFTIPQVLRPKGQEEGQETEEEDEEEEEE
AEKERTKVTFSVVFRECSVPVVMSFSVSSRHKHDSSAVVGNAKGHGQNRETQQERRKKEA
NKSTRANHNRRAMADRKRNKGMIPS
Download sequence
Identical sequences H0ZJS1
ENSTGUP00000010840 ENSTGUP00000010840 59729.ENSTGUP00000010840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]