SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010849 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010849
Domain Number 1 Region: 4-46
Classification Level Classification E-value
Superfamily UBA-like 0.0000000114
Family TAP-C domain-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010849   Gene: ENSTGUG00000010517   Transcript: ENSTGUT00000010962
Sequence length 258
Comment pep:known_by_projection chromosome:taeGut3.2.4:9:18840277:18847839:1 gene:ENSTGUG00000010517 transcript:ENSTGUT00000010962 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NKLKSSQKDKVRQFMVFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLD
RKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASITVLIIAWKFRAATQCEFSKLE
FMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAY
WNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLID
DFVEFARPQIAGTKSTTV
Download sequence
Identical sequences A0A087VAZ5 A0A091EDT1 A0A091GZR7 A0A091JT82 A0A091LKX6 A0A091M1C2 A0A091NGT3 A0A091P8U0 A0A091QJU8 A0A091RG63 A0A091SM24 A0A091SSX1 A0A091T6Y7 A0A091U1Z3 A0A091VS47 A0A093CPA8 A0A093GHC7 A0A093H6B2 A0A093JVJ6 A0A093NL49 A0A093Q4P9 A0A094K2H8 A0A094L331 A0A099Z6P7 A0A0A0A5B7 A0A226N0G4 A0A226PQW9 H0ZJT0 R0LBF1
ENSGALP00000014300 ENSTGUP00000010849 59729.ENSTGUP00000010849 9031.ENSGALP00000014300 ENSGALP00000014300 ENSTGUP00000010849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]