SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010867 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010867
Domain Number 1 Region: 10-123
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 4.05e-41
Family Pyk2-associated protein beta ARF-GAP domain 0.001
Further Details:      
 
Domain Number 2 Region: 222-370
Classification Level Classification E-value
Superfamily PH domain-like 3.22e-29
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 3 Region: 129-231
Classification Level Classification E-value
Superfamily PH domain-like 3.48e-18
Family Pleckstrin-homology domain (PH domain) 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010867   Gene: ENSTGUG00000010529   Transcript: ENSTGUT00000010980
Sequence length 378
Comment pep:novel chromosome:taeGut3.2.4:1A:50926311:50932605:1 gene:ENSTGUG00000010529 transcript:ENSTGUT00000010980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGGNERSMKALKEVWKRAENSLCADCGKPDPDWASSTLGVFICLSCSGIHRNIPSISKV
KSLKMDYWDDAQVQFLAKHGNAVTKAIYEAHIPIYYYQPTYNDCQVLREQWIRAKYERKE
FTEPGKQLPYSDEVKEGILWKRGRDNGQFLPRKFLLSEREGCLKYFTKQDAKEPKINVKI
DVINATFQPEKIGNPNGLQITYLKDNKTRNIFVYHESGKEVVDWFNAIRSVQFHYLKVAF
PIANDNEIKNRLTRNFLKEGYMEKTGPKQREAFKKRWFTLDHRRLMYFKDPLDAFAKGEV
FVGSGENGYSVQKGLPSGTQGNFSWHYGITIVTPDREYLFTCETETDQLEWIRAFTSVIN
QAMTPQEYAIEAYFKFKS
Download sequence
Identical sequences H0ZJU8
ENSTGUP00000010867 59729.ENSTGUP00000010867 XP_002195996.1.42559 ENSTGUP00000010867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]