SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010869 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010869
Domain Number 1 Region: 8-132
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.59e-22
Family Galectin (animal S-lectin) 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010869   Gene: ENSTGUG00000010541   Transcript: ENSTGUT00000010982
Sequence length 133
Comment pep:known_by_projection chromosome:taeGut3.2.4:1A:50938629:50958746:-1 gene:ENSTGUG00000010541 transcript:ENSTGUT00000010982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCQGPVCTNLGLKPGQRLTVKGKIAPNAKRTLSLGWKRRRAVLPVSHHLMHIADTNPFV
CNSKKVEEWGEHRETVFPFQRGGTAEITFAVNPNDVTVHLPGHQFTFPNRLNLSVFDYLD
TQGDFTLQSLSWE
Download sequence
Identical sequences H0ZJV0
ENSTGUP00000010869 ENSTGUP00000010869 59729.ENSTGUP00000010869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]