SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010885 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010885
Domain Number 1 Region: 2-78
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 2.09e-28
Family Surp module (SWAP domain) 0.0000368
Further Details:      
 
Domain Number 2 Region: 111-191
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 2.73e-26
Family Surp module (SWAP domain) 0.00000497
Further Details:      
 
Domain Number 3 Region: 657-768
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.29e-24
Family Ubiquitin-related 0.00000336
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010885   Gene: ENSTGUG00000010547   Transcript: ENSTGUT00000010998
Sequence length 770
Comment pep:known_by_projection chromosome:taeGut3.2.4:15:13078874:13090009:-1 gene:ENSTGUG00000010547 transcript:ENSTGUT00000010998 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PEEEPKEEAAPAKPVVGIIYPPPEVRNIVDKTASFVARNGPEFEARIRQNEINNPKFNFL
NPNDPYHAYYRHKVSEFKEGKAQEPSAAIPKVMQQQQSAQQQLPQKVQAQVIQETVVPKE
PPPEFEFIADPPSISAFDLDVVKLTAQFVARNGRQFLTQLMQKEQRNYQFDFLRPQHSLF
NYFTKLVEQYTKILIPPKGLLLKLKKEAENPKEVLDQVYYRVEWAKFQERERKKEEEEKE
KERVAYAQIDWHDFVVVETVDFQPNEQGNFPPPTTPEELGARILIQERYEKFGESEEVEM
EVESDEEDEKQEKTDEPPAQLDQDTQVQDMDEGSDDEDEGQKVPPPPETPMPPPLPPTPD
QVIVRKDYDPKASKPLPPAPAPDEYLVSPITGEKIPASKMQEHMRIGLLDPRWLEQRDRS
IREKQSDDEVYAPGLDIESSLKQLAERRTDIFGVEETAIGKKIGEEEIQKPEEKVTWDGH
SGSMARTQQAAQANITLQEQIEAIHKAKGLVPEDDSKEKIGPSKPNEIPQPPPPSSASNP
PASAQPITSVPRPPTMPPPVRAAVVSAVPVMPRPPMTSVVRLPPGSVIATPMPPIIHTPR
INVVPMPPSAPPIMSPRPPPMIVPTAFVPAPPVAPVPSPAPMPPVHPPPPMEDEPVSKKL
KSEDSLIPEEEFLRRNKGPVTVKVQVPNMQDKTEWKLNGQVLVFTLPLSDQSCVFVIKVK
IHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMTSGSLIHLALKERGGRKK
Download sequence
Identical sequences H0ZJW6
ENSTGUP00000010885 ENSTGUP00000010885 59729.ENSTGUP00000010885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]