SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010903 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010903
Domain Number 1 Region: 424-680
Classification Level Classification E-value
Superfamily YWTD domain 4.05e-62
Family YWTD domain 0.000000802
Further Details:      
 
Domain Number 2 Region: 726-982
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-57
Family YWTD domain 0.0000016
Further Details:      
 
Domain Number 3 Region: 1337-1595
Classification Level Classification E-value
Superfamily YWTD domain 7.46e-54
Family YWTD domain 0.00000562
Further Details:      
 
Domain Number 4 Region: 1033-1286
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-46
Family YWTD domain 0.00000526
Further Details:      
 
Domain Number 5 Region: 341-416,684-720
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.43e-18
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 6 Region: 247-287
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000236
Family LDL receptor-like module 0.00064
Further Details:      
 
Domain Number 7 Region: 292-328
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000497
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 8 Region: 211-249
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000864
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 9 Region: 126-166
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000196
Family LDL receptor-like module 0.00064
Further Details:      
 
Domain Number 10 Region: 49-88
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000367
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 11 Region: 170-208
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000327
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 12 Region: 87-125
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000497
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 13 Region: 1291-1336
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000798
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 14 Region: 989-1033
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000263
Family EGF-type module 0.017
Further Details:      
 
Domain Number 15 Region: 9-51
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000017
Family LDL receptor-like module 0.001
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000010903
Domain Number - Region: 1596-1634
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000244
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010903   Gene: ENSTGUG00000010533   Transcript: ENSTGUT00000011016
Sequence length 1885
Comment pep:known_by_projection chromosome:taeGut3.2.4:5:21943239:22020867:1 gene:ENSTGUG00000010533 transcript:ENSTGUT00000011016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVTSSAECSCGRNHFTCAVSAFGECTCIPAQWQCDGDNDCGDHSDEDGCMLPTCSPLDFH
CDNGKCIRRSWVCDGDNDCEDDSDEQDCPPRECEEDEFSCQNGYCIRSLWHCDGDNDCGD
NSDEQCDMRKCSEKEFRCSDGSCIAEHWFCDGDTDCKDGSDEENCPSDVPAATCSLEEFQ
CAYGRCILDIYHCDGDDDCGDWSDESDCSSHQPCRSGEFMCNSGLCINAGWRCDGDFDCD
DQSDERNCTTSMCTADQFRCKSGRCVRLSWRCDGEDDCSDNSDEENCENTGTPQCAPDQF
LCGNGRCIGQRKLCNGANDCGDGSDESPHQNCRPRTGEENCNVNNGGCAQKCQMVRGMVQ
CTCHTGYRLLEDGRSCQDVNECAEEGYCSQGCTNSEGGFQCWCEQGYELRPDKRSCKALG
PEPVLLFANRIDIRQVLPHRSEYTLLLNNLENAIALDFHHSKELVFWSDVTLDRIMRANL
NGSNVEEVVSTGLESPGGLAIDWIHDKLYWTDSGTSRIEVANLDGTHRKVLLWQNLEKPR
AIALHPMEGTIYWTDWGNTPRIEYSNMDGSNRRIIADTHLFWPNGLTIDYAGHRMYWVDA
KHHVIERADLDGRNRKAVISQGLPHPFAITVFEDSLYWTDWHTKSINSANKFTGKNQEII
RNKLHFPMDIHTLHPQRQPAGRNRCGDNNGGCTHLCLPSSKDYTCACPTGFRKTSSHACA
QSLDKFLLFARRMDIRRISFDTDDLSDDVIPLADVRSAVALDWDSKDDYVYWTDVSTDSI
SRAKWDGSNQEVVVDTSLESPAGLAIDWVTNKLYWTDAGTDRIEVSNTDGTMRTVLIWEN
LDRPRDIVVDPIGGFMYWTDWGANPKIERAGMDASNRLVIISSNLTWPNGLAIDYESQRL
YWADAGMKTIEYASLDGNHRKVLIGSNLPHPFGLTLYGERIYWTDWQAKSIQSADRRSGQ
SRETLQDNLENLMDIHVFHRHRPPVHTACEVNNGGCSHLCLLAPLPKGYSCTCPTGINLQ
SDGKTCSSGMTSFLIFARRTDIRMVSLDIPYFADVVVSVNVTMKNTIAIGVDPHEGKVYW
SDSTLRKISKQSLKHSDQNAIFSGLLTTDGLAVDAIGRKIYWTDTGTNRIEVGNLDGSMR
KVLVWQNLDSPRAIALYHEMGYMYWTDWGENAKLERSGMDGSGRVVLISNNLGWPNGLAV
DKAGSQLLWADAHTERIEAADLNGAHRRTLLSPVQHPYGLTLLDSYIYWTDWQTRSIHRA
DKDTGANVILVRANLPGLMDIQAVDRARPLGFNKCGVRNGGCSHLCLPHPTGFSCACPTG
IQLKRDEQTCDSSPETYLLFSSRASIRRISLDTSDHTDVHIPVPELNNVISLDYDSVDGK
IYYTDVFLDVIRRADLNGSNMETVIGQGLKTTDGLAVDWVARNLYWTDTGRNTIEVARLD
GSSRKVLINNSLDEPRAIAVFPKKGYLFWTDWGHIAKIERANLDGSERKILINTDLGWPN
GLTLDYDTRRSIYWTDTGTNRIEVGNLDGSMRKVLFNHYSYRVSVTQQDRWIYWTDWQTK
SIQRVDKYSGRNKETVLANVEGLMDIIVVSPQRQTGSNACGVNNGGCTHLCFARASDFVC
ACPDEPDGRPCSTIPGVVPPGPEPTSKSERSQTLPGRLGTSTTKPLTSLETVERNCSDKD
ARQGLCTRANEAVLATMGEGLHVSYIIGGLLSILFILLLIAALIIYRHNKSKFTDPGLGN
LTYSNPSYRTSTQEVKIESIPKPTMYNQLCYKKETGPDHSYTKEKIKIVEGICLLSSDDS
EWDDLKQIRSSRGGILRDHVCMKTDTVSIQASSGSLDDTETEQLLQEEQSECSSVNTAAA
TPERRGSLPDTGWKHQRKPSTESEV
Download sequence
Identical sequences H0ZJY3
59729.ENSTGUP00000010903 ENSTGUP00000010903 ENSTGUP00000010903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]