SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010915 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010915
Domain Number 1 Region: 26-109
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.03e-19
Family Mitochondrial ribosomal protein L51/S25/CI-B8 domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010915   Gene: ENSTGUG00000010579   Transcript: ENSTGUT00000011029
Sequence length 171
Comment pep:known chromosome:taeGut3.2.4:12:21415464:21416906:-1 gene:ENSTGUG00000010579 transcript:ENSTGUT00000011029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPMKGRFPVRRTLQYLSQGDVVFKSSVKVMTVNYNTAGELSEGARKFVFFNIPQIQYKNP
WVQIMLFRNMTPSPFLRFYLDSGEQVLVDVEDKTNKEITEHVKKILGKSKEMLEKEERER
KKLSHPATFGPKKYHLRECMCEIEGQVPCPAFVPLPNEMRGKYKAAMKNEA
Download sequence
Identical sequences B5G277
ENSTGUP00000010915 NP_001232040.1.42559 59729.ENSTGUP00000010915 ENSTGUP00000010915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]