SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010977 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010977
Domain Number 1 Region: 252-391
Classification Level Classification E-value
Superfamily Cadherin-like 3.93e-32
Family Cadherin 0.00000211
Further Details:      
 
Domain Number 2 Region: 483-610
Classification Level Classification E-value
Superfamily Cadherin-like 1.01e-25
Family Cadherin 0.00049
Further Details:      
 
Domain Number 3 Region: 31-175
Classification Level Classification E-value
Superfamily Cadherin-like 8.95e-22
Family Cadherin 0.0000418
Further Details:      
 
Domain Number 4 Region: 373-490
Classification Level Classification E-value
Superfamily Cadherin-like 6.28e-20
Family Cadherin 0.00012
Further Details:      
 
Domain Number 5 Region: 162-256
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000275
Family Cadherin 0.00000377
Further Details:      
 
Domain Number 6 Region: 597-702
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000108
Family Cadherin 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010977   Gene: ENSTGUG00000010620   Transcript: ENSTGUT00000011092
Sequence length 836
Comment pep:known_by_projection chromosome:taeGut3.2.4:2:110571137:110678845:-1 gene:ENSTGUG00000010620 transcript:ENSTGUT00000011092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCRVAGAPPRILPPLALMLLAALQQSGYLSCKTGFPEDVHSAVVSRSVHGGQPLLNVRFR
SCDGNKKIHFGSSEPEDFRVGEDGVVYAERSFQLSAGPTEFVVSAQDKETQQEWQRVKLT
PEQLHRGFRQDQRKIEEIIFPWQQYKHSSSLKRQKRDWVIPPINLPENSKGPFPQELVRI
RSDRDKSLSLRYSATGPGADQPPTGIFIINPISGQLSVTKPLDREQIASFHLRAHAVDVN
GNQVENPIDIVINVIDMNDNRPEFLHQVWNWTVPEGSKPGTYVMTVTAIDADDPNTQNGM
LRYRILSQAPSSPSPNMFTINNETGDIITVAAGLDREKVQQYTLIIQATDMEGNPTYGLS
NTATAVITVTDVNDNPPEFTAMTFYGEVPENRVDVIVANLTVTDKDQPHTPAWNALYRMT
GGDPTGRFTILTDPNSNDGLVTVVKPIDFETNRMFVLTVAAENQVPLTKGIQHPPQSTAT
VSITVIDVNESPYFVPNPKLVRQEEGLMAGSMLTTFTAQDPDRYMQQTSLRYSKLSDPAN
WLKIDPVNGQITTTAVLDRESIYVQNNMYNATFLASDNGIPPMSGTGTLQIYLLDINDNA
PQVHPKEATTCETLQPNAINITAVDPDIDPNAGPFAFELPDTPASIKRNWTIVRISGDHA
QLSLRIRFLEAGIYDVPIVITDSGNPHASSTSLLKVKVCQCDLNGDCTDVDRIVGAGLGT
GAIIAILLCIIILLILVLMFVVWMKRRDKERQAKQLLIDPEDDVRDNILKYDEEGGGEED
QDYDLSQLQQPDTLEPDAIKPVGIRRLDERPILAEPQYPVRSAAPHPGDIGDFINE
Download sequence
Identical sequences H0ZK57
59729.ENSTGUP00000010977 ENSTGUP00000010977 ENSTGUP00000010977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]