SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010994 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010994
Domain Number 1 Region: 215-351
Classification Level Classification E-value
Superfamily Cadherin-like 1.06e-26
Family Cadherin 0.0003
Further Details:      
 
Domain Number 2 Region: 445-570
Classification Level Classification E-value
Superfamily Cadherin-like 5.1e-18
Family Cadherin 0.0022
Further Details:      
 
Domain Number 3 Region: 333-452
Classification Level Classification E-value
Superfamily Cadherin-like 1.13e-16
Family Cadherin 0.00024
Further Details:      
 
Domain Number 4 Region: 128-227
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000366
Family Cadherin 0.0011
Further Details:      
 
Domain Number 5 Region: 556-653
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000101
Family Cadherin 0.0075
Further Details:      
 
Domain Number 6 Region: 15-139
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000377
Family Cadherin 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010994   Gene: ENSTGUG00000010651   Transcript: ENSTGUT00000011109
Sequence length 874
Comment pep:novel chromosome:taeGut3.2.4:2:111733082:111752774:-1 gene:ENSTGUG00000010651 transcript:ENSTGUT00000011109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLFHLLVLSLCCEACKKVIFHVPSELEADTLVGRVDLKECLQSAEFISSSDGRFKVLEDG
SVYTTSALSLSAEKKTFTILLKDIQEQVQKKIQVDLVEEEKKTPNKRHARDTVLKRTKRR
WGPIPSVMIENSLGPFPLQIQQVQSDTAQNYTIYYSASGPGIDQDPKGLFYIERETGNIF
ATRAVDREQYPSFQIICFATTPDGYSPEVPLVHTIRIEDDNDNAPYFTQDHFEFCVPENS
RPGVFVGKVTAEDRDEPYTLHTTLKYRIVSQTPPITPAFSLHGDTGVISVLLPQLDRELV
PSYTLLVEVRDMAGQPFGLCTTGTVVIKIEDTNDNAPSFKQLQYETRVEENRVSVEILRV
SVVDLDEPGSPGSGAVYEIIRGNDDQAFEITTDKNTNEGILCVVKGLDYETAKQRILVIG
VNNEAPYLLAPHSQQLSQSTCSVTVHVLDVDEGPVFKPCLLRLDVKECEDIGTAIGRYIA
EDPESGNTEGIRYRIPPGQCNWINIDEQSGEVRTVRVLDRDIGEMRRGQCNVTVLAIDRN
GKTGTGTIQVCIVPGNKNFPRISQTDYIMCRDRKPICLTAQDGDEAPYSAPFVYRITDRR
LASMWKLTPHDDNSWYLSPKSDTPYGIYEIPVTVIDNGGKRGENIVRVNLCDCVTPTECD
GRARQLSGGNVTLGLWAILAMILGSLLLLLILITICGCCGAGAMHRQVTDDCANHNLIIS
NTEAPGEEVMDQNIIPLQNTCDQGGYGVKTGEQQTFEMVKGRGHTLESVKGGGHQTLGSV
KEGGGQTVMDTCRYSYSEWHNFTHPRLGEKVHLCRQDEEQKHSEDYLLSYNYEGKGSLAG
SVGCCSDQHEEEALDFLDQLEPKFRTLAETCIKR
Download sequence
Identical sequences H0ZK74
59729.ENSTGUP00000010994 ENSTGUP00000010994 ENSTGUP00000010994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]