SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011000 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011000
Domain Number 1 Region: 495-755
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.95e-89
Family Eukaryotic proteases 0.0000469
Further Details:      
 
Domain Number 2 Region: 290-396
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000131
Family Spermadhesin, CUB domain 0.0035
Further Details:      
 
Domain Number 3 Region: 29-147
Classification Level Classification E-value
Superfamily SEA domain 0.0000000000000693
Family SEA domain 0.0056
Further Details:      
 
Domain Number 4 Region: 188-273
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000103
Family Spermadhesin, CUB domain 0.0075
Further Details:      
 
Domain Number 5 Region: 438-472
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000183
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 6 Region: 404-436
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000288
Family LDL receptor-like module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011000   Gene: ENSTGUG00000010661   Transcript: ENSTGUT00000011115
Sequence length 756
Comment pep:known_by_projection chromosome:taeGut3.2.4:1A:51306364:51323585:1 gene:ENSTGUG00000010661 transcript:ENSTGUT00000011115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLLVIAFLVLAGAAAATWYFLGKNSHPSILQFYCGSLQVLNRQYSPDLGQVESRAFWVES
AKLQNMLKELIRATELGRYYNSSTVYAFGEGALTFFFWFTLQIPESQQKEATAERVNTVL
HQELSTSFNSSGSLSYQKEYRVNPDSLVLLESSVKDIVVLQSTLGCYRYSYVQEDDVLRL
EGPDYLASSCLWHLHGLKGYMIKLRLEWTLPDCRDRLAMYDAAGPLEKHLITSIYGCSRQ
EPIIEVLSSGPVMSIVWKKAMYSYYDPFILSAQVVPLEACEVNITLRESLELQGKIGTPH
YPSYYSPNTQCTWHMTVPSLDYGVTLWFDAYALSRQKHDLPCTQGQWIIQNRRLCGLRTL
QAYAERIPVTSSADITITFTSQISLTGPGLQAAYSLYKQSDPCPGEFLCLVNGLCVPACD
GIKDCPNGLDERNCVCPAKFQCREDSTCIEFSRVCNQQLDCVNGSDEEHCSCLVLCGPFT
YRCEDGTCVKKPNPLCDTTADCKDLSDENHCDCGMQAPLSRIVGGMNSVEGEWPWQASLQ
VRGRHICGGTLIADRWVVSAAHCFQDERLASPFIWTVYLGKYLQNATGHTEVSFKVIHLF
LHPYYEEDSHDYDVALLQLDHPVIISPLIQPICLPPPSHIFEPGLLCWSTGWGALKEGGH
ISNVLQKVDVQLIQQNICSEAYHYTITPRMLCAGYYQGKKDACQGDSGGPLACKEPSGRW
FLAGLVSWGMGCARANHYGVYTRITQVLGWMNQTMS
Download sequence
Identical sequences H0ZK80
ENSTGUP00000011000 ENSTGUP00000011000 59729.ENSTGUP00000011000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]