SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011031 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011031
Domain Number 1 Region: 103-237
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-25
Family Cadherin 0.0003
Further Details:      
 
Domain Number 2 Region: 330-460
Classification Level Classification E-value
Superfamily Cadherin-like 9.29e-17
Family Cadherin 0.0021
Further Details:      
 
Domain Number 3 Region: 218-312
Classification Level Classification E-value
Superfamily Cadherin-like 9.99e-16
Family Cadherin 0.00057
Further Details:      
 
Domain Number 4 Region: 30-115
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000004
Family Cadherin 0.00074
Further Details:      
 
Domain Number 5 Region: 456-546
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000222
Family Cadherin 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011031   Gene: ENSTGUG00000010683   Transcript: ENSTGUT00000011148
Sequence length 597
Comment pep:known_by_projection chromosome:taeGut3.2.4:2:111899997:111910857:1 gene:ENSTGUG00000010683 transcript:ENSTGUT00000011148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVRQKREWTVPPAFIREEEDNSYKNPIARIHSDLEDTGIVVTYTISGQGVTQPPYGLFVI
NGKTGDLNITGRVDREKTPMLLVRGHALDKNGAKLEEPIDLPIKVVDINDNFPVFSQEVF
VGSVEELSETGTIVMRINATDADEPNNLNSKIAFRIVSQSPSTPFIIDKNTGEVRVAIIN
LDRETQSSYSLVVEAKDRGGEKDGNAATCSLEIKILDVNDNLPVVESRTFEASIEENRAN
VEIMRIKVFDKDEEFSDNWLANFTFVSGNEGGFFKIVTDTQTNEGILTVVKELDYEKMQS
LNLGIVVTNKAEFHKSIKASYKAETIPIKIKVINVKEGPVFPGGTKIIEASEKTQIKQVI
GQYQAYDEDTGKIAEHITYMKGKDAANWITVDSVTGEILLAKNLDYESLHVVNGTYTITM
LGVTTDSPRKTITGTVVIQVKDENDNCPVIVNPVRTVCSDAQVVDVTANDLDGYPNSYPF
SFTVIDEPEGTAAKWIIASRNDTSIQLVPQNLKPGRTEVPILIKDFQGVSCALPQSLQLT
VCGCADRGVCQEKFVGSNSVGLAPAAVALIILAFLLLLLVPLLLLLCPGGLGAKGFT
Download sequence
Identical sequences H0ZKB1
ENSTGUP00000011031 59729.ENSTGUP00000011031 ENSTGUP00000011031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]