SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011082 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011082
Domain Number 1 Region: 23-217
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.29e-52
Family Astacin 0.0000358
Further Details:      
 
Domain Number 2 Region: 331-443
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.23e-35
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 3 Region: 223-332
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.77e-31
Family Spermadhesin, CUB domain 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011082   Gene: ENSTGUG00000010750   Transcript: ENSTGUT00000011202
Sequence length 443
Comment pep:novel chromosome:taeGut3.2.4:5:22989778:23001232:1 gene:ENSTGUG00000010750 transcript:ENSTGUT00000011202 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSEITVYEGDILLRRGRRSAINCESCLWPKSQDGLVKVPVNISSDFSITERSWIADALQE
ISTLTCVQFVNRTTETDYVYVERGQSCWSYFGKIGGRQAVGLVKNGCMDKGAIQHEMNHA
LGFIHEQARSDRDRFVKIMWEHIVAGEQGNFGKVNSKNLGLPYDYSSVMHYGAYDFSSTP
GKPTIVPVPDPSIPIGQREGLSNLDVAKINKLYKCNCCSSVLPKPKGSFSSVNYPSPYPN
NSNCLWLIRIRRSKIFLQFEAFDLQRSSDCSSDYIKIYNGNSKSSPVLLDKYCGKGPLPS
LVASGSTMLVEFASDESITATGFRASYNRVNCGATFRDSKGVITSPNYPNKYPKNRACFW
VITSPVGYKISLKMLSFELEYSDRCIFDYLLIHDGSRPMSPAVGPYCGTEKVADFTSTGN
FVLVEFHSDLVWELPGFVMSYTF
Download sequence
Identical sequences H0ZKG2
59729.ENSTGUP00000011082 ENSTGUP00000011082 ENSTGUP00000011082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]