SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011093 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011093
Domain Number 1 Region: 701-1061
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.15e-88
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.0000000568
Further Details:      
 
Domain Number 2 Region: 515-697
Classification Level Classification E-value
Superfamily ARM repeat 5.76e-64
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.0000204
Further Details:      
 
Domain Number 3 Region: 107-298
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.82e-42
Family Ras-binding domain, RBD 0.0011
Further Details:      
 
Domain Number 4 Region: 332-473
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.98e-42
Family PLC-like (P variant) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011093   Gene: ENSTGUG00000010736   Transcript: ENSTGUT00000011213
Sequence length 1069
Comment pep:known_by_projection chromosome:taeGut3.2.4:9:20133140:20151533:-1 gene:ENSTGUG00000010736 transcript:ENSTGUT00000011213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLLTIKHELFKEARKYPLY
QLLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGF
AIGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDVNAPHSRALYVYPPNVESSAELPK
HIYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQL
KLCVLEYQGKYILKVCGCDEYLLEKCPLSQYKKSTIRSCIMLGGMPKLILMAKESYKQLP
LDTFTMSYSRRISTATPYMNGEATTKSLWTINSALRIRILCATYVNVNIRDIDKIYVRTG
IYHGGEPLCDNVNTQRVPCSNPRWNEWLLYDMYIPDLPRAARLCLSICSVKGRKGAKEEH
CPLAWGNINMFDYTDTLVSGKMALNLWAVPHGLEDLLNPIGVTGSNPNKETPCLELEFDW
FSNPVKFPDMTVIEEHANWTISRELGFNYSYAGQSNRIARDSELTESDKEQLRAICTRDP
LSEITEQEKDFLWRHRHYCVNTPEILPKLLLSVKWNSRDEVAQMYCLVKDWPSIKPEQAM
ELLDCNYPDPMVRAFAVRCLEKSLTDDKLSQYLIQLVQVLKYEQYLDNQLVRFLLKKALT
NQRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLSRQVEAMEKLINLTDIL
KQEKKDETQKVQMKFLVEQMRRPDFMDALQGFISPLNPAHQLGNLRLEECRIMSSAKRPL
WLNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCL
SIGDCVGLIEVVRSSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGDMYDAAIDLFTR
SCAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQD
FLIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDI
AYIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
Download sequence
Identical sequences H0ZKH3
59729.ENSTGUP00000011093 ENSTGUP00000011093 ENSTGUP00000011093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]