SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011096 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011096
Domain Number 1 Region: 38-226
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.04e-52
Family Astacin 0.0000938
Further Details:      
 
Domain Number 2 Region: 395-560
Classification Level Classification E-value
Superfamily TRAF domain-like 4.74e-35
Family MATH domain 0.001
Further Details:      
 
Domain Number 3 Region: 235-398
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.14e-31
Family MAM domain 0.0011
Further Details:      
 
Domain Number 4 Region: 585-625
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000115
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011096   Gene: ENSTGUG00000010758   Transcript: ENSTGUT00000011216
Sequence length 664
Comment pep:known_by_projection chromosome:taeGut3.2.4:2:112187280:112206503:1 gene:ENSTGUG00000010758 transcript:ENSTGUT00000011216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DIDGGIDRDIFDINEALGLDLFEGDIKLPGERNSIIGDNYRWPHVVPYVLEDSLEMNAKG
VILKAFEQYRLKTCIDFKPWEGEKNYISVFKGSGCWSSVGNMQMGLQQLSIGASCDRIGT
IQHEFLHALGFWHEQSRSDRDDYVSIIWDRIQSGKGHNFNKYDDKKSDFLNVPYDYNSVM
HYSKTAFRNGTEPTIITNIPEFIDVIGQRMGFSEYDLQKLNRLYNCTSSLSFMDTCSFEL
ENVCGMIQSSDDNSDWQRLSQVPAGPNTDHTNMGECKDSGYFMHFDTSAGGEGSTAVLES
RILYPKRGFQCLQFYLYNSGNESDQLNVWVREYTSADPNGTLRFIKEIKGSPETYWQLHH
VSLNVTSKFRVVFQGVKGSGLSNGGLSIDDINLSETQCPHHVWHIRNFTQLLNTSGAVYS
PPFYSSEGYAFQVSLYVNGTIDSPFNLGIYLSLISGANDDQLKWPCPWQQGTMILLDQHP
DIRQQMSNQRSITTDPLKLSGSSSNYIWDRPDKVGSEATFPNGTKYMRGPGVGTSAFLTH
ERLRSRNFIKEDGVYILLTMEDISHLLASTTKPGPRPTATTKPPTFCSDNPCENDGVCVM
VNRAPTCRCPAGDNWWYMGEKCERKGSTQENTVIAVSSTITVFVVMLIVTITTAVCLKKK
YKQR
Download sequence
Identical sequences H0ZKH6
ENSTGUP00000011096 59729.ENSTGUP00000011096 ENSTGUP00000011096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]