SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011100 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011100
Domain Number 1 Region: 326-385
Classification Level Classification E-value
Superfamily BPTI-like 4.68e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0029
Further Details:      
 
Domain Number 2 Region: 197-259
Classification Level Classification E-value
Superfamily BPTI-like 5.39e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0046
Further Details:      
 
Domain Number 3 Region: 277-313
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000327
Family LDL receptor-like module 0.002
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000011100
Domain Number - Region: 168-199
Classification Level Classification E-value
Superfamily PKD domain 0.0863
Family PKD domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011100   Gene: ENSTGUG00000010764   Transcript: ENSTGUT00000011220
Sequence length 468
Comment pep:novel chromosome:taeGut3.2.4:5:23038608:23055189:1 gene:ENSTGUG00000010764 transcript:ENSTGUT00000011220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKPFGEMCLEDFTAGLPDWVLDTDASVQNGATFLSSPMVHRSRDCMRACCKDPACNLALV
EQGPGSEEDRIQGCFLLNCLYEKAFVCRFARKIGFLNFLKKDVYDSYLAMQNHRPSGKVP
RVWKSINDICLKVSIQVPFPLMQERELYIALVTSSLEVKHEEDQVELSNLQVGTYVFQLI
VTDTAQQQDFTNITIMVLSSEQTEEHCLTPKKVGWCRGSFPRWFYNPSLQQCEEFIFGGC
KPNKNNYLREEECALACKNVRGDTAASWLTPICNGNCQAPFFRCKDGCCIDAYLECDETP
DCADESDEMYCEQFTGAEDGLPSHLYLALPGHCVDLPDTGQCTESISRWYYNPFLEKCDP
FTYGGCGGNSNNFEQEEECMKSCSGITSKHTSPSLLTCSFIPAGAFEVVIAVLLGICIMV
VLAFIGYFFLKKRKKSSHRHQPPTATNSTLSTTEDTERLFYSSATKPV
Download sequence
Identical sequences H0ZKI0
59729.ENSTGUP00000011100 ENSTGUP00000011100 ENSTGUP00000011100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]