SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011161 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011161
Domain Number 1 Region: 227-479
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.54e-77
Family Eukaryotic proteases 0.0000993
Further Details:      
 
Domain Number 2 Region: 101-207
Classification Level Classification E-value
Superfamily Kringle-like 1.09e-30
Family Kringle modules 0.00027
Further Details:      
 
Domain Number 3 Region: 2-42
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000178
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000011161
Domain Number - Region: 40-76
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00215
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011161   Gene: ENSTGUG00000010815   Transcript: ENSTGUT00000011281
Sequence length 485
Comment pep:novel chromosome:taeGut3.2.4:6:27404784:27411766:1 gene:ENSTGUG00000010815 transcript:ENSTGUT00000011281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADSCSSSPCKNGGTCEARGSGFSCRCPTPYGGTTCEKVEDTCLEKNCHFGDCLIILTPPY
FKCSCKPPYKRPSCQRASKQCSPNPCRNGGTCKRNRYRSKFTCECPEPFRGRFCEIGPND
CYEEDSSTYRGRVNQAENGRTCLHWNSHHLLDHPFNAFMEDADSYGIGEHNFCRNPDGDE
KPWCYIRKNNEVDWEYCDVSPCSGKELKATEETPTEPPTDPPEIFKTCGQPEVHRTLKKI
YGGSKATPGKHPWMASLQTRTLDGNKHFCGGVLIKSCWVLTAAHCLQEPKPNIQVVLGKQ
NLKKKEDHEQIFDAVHIVLHGKYREEPGHALYNDIALLKLQPVDGYCAVETKHVKIACVP
DFFLPAGTSCFISGWGSTETGDLSHQLLDANVKLISQRKCNEPKLHDDKLDDSMFCAGNL
RKPEIDSCEGDSGGPLTCVQNGSYYVYGLVSWGEGCGLKNKPGVYTQVTKFASWINAAIQ
SASRS
Download sequence
Identical sequences H0ZKP0
59729.ENSTGUP00000011161 ENSTGUP00000011161 ENSTGUP00000011161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]