SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011167 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011167
Domain Number 1 Region: 66-246
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.38e-43
Family CBM11 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011167   Gene: ENSTGUG00000010829   Transcript: ENSTGUT00000011287
Sequence length 265
Comment pep:known_by_projection chromosome:taeGut3.2.4:5:23445720:23451657:-1 gene:ENSTGUG00000010829 transcript:ENSTGUT00000011287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SKLYSSYRRPGAEPEKKLSWQNADFSFKKAVDHLKTQLSLLKKETQDYLKGPGGHPLSQH
LLEQTRVLWQFRSQEDLNKWVISSDVEIGGKSKVYIKLGRNNQAALLYGTLNTEVPRDGE
TQYSGYCSMRSRPAVGSFNRKKYYDWSNFNSLYLRVRGDGRPWMVNIYTDPYFSHQKDDL
YTYFMFTRGGPYWEEIQIPFSKFFLSSRGRVQDNQHPVWLDKIRTLGFTIGDKVDGPFQL
EIDFIGLLNDRAHKEKFAYEAYDKN
Download sequence
Identical sequences H0ZKP6
59729.ENSTGUP00000011167 ENSTGUP00000011167 ENSTGUP00000011167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]