SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011168 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011168
Domain Number 1 Region: 621-671
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000214
Family RING finger domain, C3HC4 0.0087
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000011168
Domain Number - Region: 256-300
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0142
Family Thioltransferase 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011168   Gene: ENSTGUG00000010834   Transcript: ENSTGUT00000011288
Sequence length 686
Comment pep:known_by_projection chromosome:taeGut3.2.4:4:65856484:65872178:-1 gene:ENSTGUG00000010834 transcript:ENSTGUT00000011288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWVKLCCLLLYFLALFVLARVFEAVAWYESGFLATQLVDPVALSFRKLRTILECRGLGHS
GLPEKKDVRELQENVRDLMEGELYSALKEEEASESVSSTNFSGEMHFYELVEDTKDGIWL
VQVIANDRSPLVGKVHWEKMVKKVSRFGIRTGTFNCSSDPRYCKRRGWLKSTLIMSVPQT
STSKGKVMLKEYSGRRIEVEHIFKWITAHAASRIKTIYNSEHLKEEWNKSDQYRVKIYLF
ANLDQPPAFFSALSVKFTGRVEFIFVNVENWDNKSYMAEIGIYKTPSYILRTPEGIYRYG
NNTGEFISLRAMDSFLRSLQPEVNDLFVLSLVLVNLMAWMDLFITQGATIKRFVVLISTL
GTYNSLLIISWLPVLGFLQLPYLDSFYEYSLKLFRYSNTTTLASWVRADWMFYSSHPALF
LSTYLGHGLLIDYFEKKRRRNNNMDEVNANNLEWLSSLWDWYTSYLFHPIASFQHFPFDS
DWDEDPDLLLERLAFPDLWLHPLIPTDYIKNLPMWRFQCLSSHSDEEMLETFPDSESDSE
SENKEVFSSDREVSEDDELSTLHRCSEAERQGSAEACSCATHSCHHEPCERQARSYSLYS
SAGDLEPDWSAWPSDMLHCTECVVCLENFAKGCLLMGLPCGHVFHQNCIMKWLAGGRHCC
PVCRWASYKKKQPYTHPQPLSSEPPS
Download sequence
Identical sequences H0ZKP7
ENSTGUP00000011168 ENSTGUP00000011168 59729.ENSTGUP00000011168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]