SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011207 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011207
Domain Number 1 Region: 259-300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000131
Family Integrin beta EGF-like domains 0.02
Further Details:      
 
Domain Number 2 Region: 344-381
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000502
Family Integrin beta EGF-like domains 0.01
Further Details:      
 
Domain Number 3 Region: 180-208
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000335
Family Integrin beta EGF-like domains 0.031
Further Details:      
 
Domain Number 4 Region: 86-114
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000103
Family Integrin beta EGF-like domains 0.023
Further Details:      
 
Domain Number 5 Region: 308-345
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000179
Family Integrin beta EGF-like domains 0.008
Further Details:      
 
Domain Number 6 Region: 1-24
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000893
Family Integrin beta EGF-like domains 0.033
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000011207
Domain Number - Region: 219-257
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000363
Family Integrin beta EGF-like domains 0.023
Further Details:      
 
Domain Number - Region: 35-72
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000419
Family Integrin beta EGF-like domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011207   Gene: ENSTGUG00000010867   Transcript: ENSTGUT00000011327
Sequence length 389
Comment pep:known_by_projection chromosome:taeGut3.2.4:1:38529438:38598605:-1 gene:ENSTGUG00000010867 transcript:ENSTGUT00000011327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GHGKCDCGKCKCDEGWYGEACQYPATCNLTRRKSNEMCKNSQDIICSGAGTCQCGRCQCA
NSEENGLVYGKFCECDDRECIDDETGEICTGHGKCYCGNCYCEAGWHGDKCEFQCDITPW
EIKKRCTSPDGKICSNRGTCVCGECTCHDVDPTGDWGDIHGDTCECDERNCKAVYDRYSD
DFCSGHGQCNCGRCDCKEGWTGQKCEHPHSCPMSVEESTKKCQGNSNLPCSGRGRCECGQ
CTCFPPGDNRVHGKNCECDDRQCENADGDVCGGHGICSCGRCICQDGWFGKLCQHSRKCN
MTEEESRSLCESADGILCSGKGSCHCGKCICSPQEWYISGDFCECDDRDCDKHDGLICTG
NGICSCGNCECWEGWNGNACEIWLGREYP
Download sequence
Identical sequences H0ZKT6
ENSTGUP00000011207 59729.ENSTGUP00000011207 ENSTGUP00000011207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]