SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011219 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011219
Domain Number 1 Region: 213-377,404-558
Classification Level Classification E-value
Superfamily NHL repeat 2.51e-32
Family NHL repeat 0.0056
Further Details:      
 
Domain Number 2 Region: 62-182
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.67e-21
Family Glutathione peroxidase-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011219   Gene: ENSTGUG00000010878   Transcript: ENSTGUT00000011339
Sequence length 728
Comment pep:known_by_projection chromosome:taeGut3.2.4:6:27545355:27574121:1 gene:ENSTGUG00000010878 transcript:ENSTGUT00000011339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGGLAGLLPAQTQLEYALLDADTAQEKENLVYQYVKKMDSRERDLAVPELGGDLQWLN
TEGPISLHKDLCGKVVVLDFFTYCCINCLHLLPDLHALEHQYSDKDGLVIVGVHSAKFPN
EKVLDNIKSAVLRYNIVHPVVNDADATLWHELEVSCWPTLVILGPRGNMLFSLVGEGHRE
KLFLFTSITLKFYKERGQIKDNNIGIKLYKDSLPPSPLLFPGKVAVDDSGGRLVIADTGH
HRILVTRKNGQILHTIGGPNSGRRDGRFSEAAFNSPQGIAIKNNVIYVADTENHLIRKID
LELQMVTTVAGIGVQGVDKEGGAKGEEQPISSPWDVVFGSSISGTQEDDVLWIAMAGIHQ
IWALMLEGGKLPKGSDLKKGVCLRFAGSGNEENRNNAYPHKAGFAQPSGLSLAPEEPWSC
LFVADSESSTVRTISLKDGAVKHLVGGERDPLNLFAFGDVDGAGINAKLQHPLGVTWDKK
RQLLYVADSYNHKIKVVDPKMKNCATLAGTGEAGNVVGSSFTQSAFNEPGGLCVEENGRL
MYVADTNNHQIKVLDLETKILSMAILPILKPDACDVPDNLPVQKDKITNLPRLPKSAPNV
KLPSLTVAPGQTIQFLLKLNLPLDSKLNEEAPSAWFITAEDNTWLLQGQCLTGEIKDISS
QTVIPFQLPGSCVSAEATLAIKACLYYCSKGSSACMMAGVSFSQPLQVTGTDQGSSAQVE
LIHTFVTN
Download sequence
Identical sequences H0ZKU8
59729.ENSTGUP00000011219 ENSTGUP00000011219 ENSTGUP00000011219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]