SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011247 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011247
Domain Number 1 Region: 284-355,383-400
Classification Level Classification E-value
Superfamily F-box domain 9.03e-18
Family F-box domain 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000011247
Domain Number - Region: 10-53
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000135
Family Ubiquitin-related 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011247   Gene: ENSTGUG00000010909   Transcript: ENSTGUT00000011368
Sequence length 487
Comment pep:known_by_projection chromosome:taeGut3.2.4:1A:53088664:53096747:-1 gene:ENSTGUG00000010909 transcript:ENSTGUT00000011368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSDTAFSVTLNRKDALTEDQKTLASYGIVSGDLICLLLEEPDAQPSLPPPPATPAPLQNG
HEPTTLTPNNSQANSPREGQNEQSNNEKAQVEVQESDERAGSSLEFPSGLVPEDADLEEG
TGSYPSEPMLCSEAADGETPHSLEMLYLSAECTSATDALIVLVHLLMMETGYVPQGIEAK
AVFMPEKWRGNGVYKLQYTHPLCGEGCAGLTCVPLGDLIAINATLKINEEIRSVKRIQLL
PSSFVCFQDPEKVAGVYKDLQKLSRLFKDQLVYSLLAAARQALNLPDVFGLLVLPLELKL
RIFRLLDVRSLISLSAVCRDLYTASNDQLLWRFMYLRDFRDPIARPRDTDWKELYKKKLK
QKKEALRWRHMMLLPPIPHPIPFHPNPFYPNPFPPNPFPSNPIYPPMIIGGEYDERPTLP
YVGDPINSLIPGQGEAPGQFPPFRPHFDPIGSLPGANPMLPGRVGSSDRFPPRPSRGRPM
DIRRAFI
Download sequence
Identical sequences H0ZKX5
ENSTGUP00000011247 59729.ENSTGUP00000011247 ENSTGUP00000011247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]