SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011297 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011297
Domain Number 1 Region: 278-333
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000151
Family UBA domain 0.013
Further Details:      
 
Domain Number 2 Region: 4-186
Classification Level Classification E-value
Superfamily Rhomboid-like 0.00000000000262
Family Rhomboid-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011297   Gene: ENSTGUG00000010963   Transcript: ENSTGUT00000011419
Sequence length 333
Comment pep:known_by_projection chromosome:taeGut3.2.4:1:39799058:39883327:-1 gene:ENSTGUG00000010963 transcript:ENSTGUT00000011419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DKAPLSKSLLLVPSAISILLTLLFQHYQKFFAYNLQAVKEDFQIWRLVCGRTICLDLKDT
FCSSLLIYNFRIFERRYGSRKFSSFLLGAWMLSALFDLLLVEITQYMFGITINSLPSGFL
GPVFALFVPFYSSIPRVQVTQVLGHFSITNKSLVYILGLQLLTSGSYIWILALSGLISGI
CYNSSILKVHRILCVPRWVAKIFSWTLEPVFSSAEPTNEVRVGMGATVDIQRQQRMELLD
RQIMMSQVAQMRRQRQQQGGMINWNRLFPPLRHRQNANYQDHPSEQGIPPPTEVSEEQVA
RLMEMGFSRGDALEALRASNNDLNVATNFLLQH
Download sequence
Identical sequences H0ZL24
ENSTGUP00000011297 59729.ENSTGUP00000011297 ENSTGUP00000011297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]