SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011345 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011345
Domain Number 1 Region: 354-618
Classification Level Classification E-value
Superfamily Kelch motif 2.35e-40
Family Kelch motif 0.0086
Further Details:      
 
Domain Number 2 Region: 710-879
Classification Level Classification E-value
Superfamily C-type lectin-like 7.35e-25
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 3 Region: 92-214
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.71e-21
Family Spermadhesin, CUB domain 0.002
Further Details:      
 
Domain Number 4 Region: 1016-1062
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000213
Family Laminin-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011345   Gene: ENSTGUG00000010983   Transcript: ENSTGUT00000011469
Sequence length 1220
Comment pep:novel chromosome:taeGut3.2.4:6:28226525:28549642:1 gene:ENSTGUG00000010983 transcript:ENSTGUT00000011469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APAAKMDLGSAGRRAGAAPAGPAAWRPFPSACCCCFASLLDVNSWLLFYGFLYLALYAQV
SQSKSCDKISCFSGHCVNSTCVCDQGWVGDQCQHCQGRFKLTEPSGYLTDGPINYKYKTK
CTWLIEGYPNAILRLRFNHFATECSWDHMYVYDGDSIYAPLIAVFSGLIVPEVRGNETVP
EVVTTSGYALLHFFSDAAYNLTGFNIFYSINSCPNNCSEHGKCTTSVSVPSRVYCECDKY
WKGEACDIPYCKANCGSPDHGYCDLTGEKLCVCNDSWQGPDCSLNVPSTESYWILPNVKP
FSPSVGRASHKAVLHGKFMWVIGGYTFNYSSFQMVLNYNLESSIWNVVPVSKGPLQRYGH
TLALYQEDIYMYGGKIETSYGNVTDELWVFNIPSQTWSTRVPAVLVHGQQYAVEGHSAHI
VELDSRDVVMIVIFGYSSIYGYTSIVQEYYIRSNSWLVPETKGAIVQGGYGHTSVYDELT
KSIYVHGGYKALPGNKYGLVDDLYRYEVNTRTWTILKESGFARYLHSAVLINGAMLIFGG
NTHNDTSLSNGAKCFSADFLSYDIACDEWKILPKPNLHRDVNRFGHTAVVSNGSMYIFGG
FSSVLLNDVLVYKPPNCEAFRDEELCKNARPGIRCLWNKKHCESWESGHANNILRAKCPK
KTAAADDRCYRYADCASCTANTNGCQWCDDKKCISAHSNCSMSVKNYTKCHVRNEQICNK
LTSCKSCSLHLNCQWDQRQQECQALPAHLCGERWNHIGDACLHINSSRESYDNAKLYCYN
LSGNLASLTTSKEVEFVLDEMQKYTLQKISPWVGLRKINISYWGWDDMSPFTNTTLQWLP
GEPNDSGFCAYLERAEVAGLKANPCTAMADGLVCEKPVVSPNQNARPCKKPCSLRTTCSN
CTSNGMECMWCSSTKRCVDSNAYIISFPYGQCLEWQTATCSPQNCSGLRTCGQCLEQPGC
GWCNDPSNTGKGQCLEGSSRGPMKPVSVHSNEMVLDATLCPKEKNYEWSFIQCPACQCNG
HSTCINSNVCDQCRNLTTGKQCETCMPGYYGDPTNGGQCTACTCSGHANICHMQTGKCFC
TTKGIKGDQCQLCDSENRYLGNPLRGTCYYSLLIDYQFTFSLLQEDDRHHTAINFIANPE
QSNKNLDISINASNNFNLNITWSIGSTAGTISGEEIPVVSKVNIKEYRDSFSCEKFNFRS
NPNITFYVYVSNFSWPIKIQ
Download sequence
Identical sequences H0ZL72
ENSTGUP00000011345 ENSTGUP00000011345 59729.ENSTGUP00000011345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]