SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011354 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011354
Domain Number 1 Region: 177-304
Classification Level Classification E-value
Superfamily PH domain-like 1.28e-24
Family Pleckstrin-homology domain (PH domain) 0.00000142
Further Details:      
 
Domain Number 2 Region: 835-927,996-1070,1141-1181,1306-1329,1428-1563
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000487
Family Exportin HEAT-like repeat 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011354   Gene: ENSTGUG00000010967   Transcript: ENSTGUT00000011478
Sequence length 2107
Comment pep:known_by_projection chromosome:taeGut3.2.4:1:39938582:40032741:1 gene:ENSTGUG00000010967 transcript:ENSTGUT00000011478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCTTSVILFKGIRTVFERNCGYICKQQGENNALEYTAFSLPDEDSEILIHSFLAKPKLI
EPIDYENVIVQRKTQILNDPLREMLLFPYDDFQTALLQRQSRYIRSTVPENAEKAAQSLF
VTECIKTYNSDWHIVNYRYEDYSGEFRQLPNKGTKPDKLPVHLYEVDEEADKDEDAASLG
SQKGGITKQGWLYKGNMNSAISVTMRSFKRRFFHLIQLGDGSYNLNFYKDEKISKEPKGS
IFLDSCMGVVQNNKVRRFAFELKMQDKSSFLLAADSELEMEEWINTLNKILQLNFEAAMQ
EKRNGESHEDDEQSKLESSSSSFDNYYPEIAKSTREAEIKLKTESRVKLFALDPDAQKLD
FSNIEPEVKPFEEKFGKKILVRCNDLSFNLQSCVAENEEGPTTNVEPFFVTLSLFDIKNN
RKISADFHVDLNHASVRHMLSSASQQMMNGSGDSLHRIQDIHETVLQYPKQGIFSVTCPH
TDIFLVAKIEKVLQGSITHCAEPYMKSSDSSKVAQKVLKNAKQACQRLGQYRMPFAWAAR
TLFKDASGTLDKNARFSALFRQDSNKLSNEDMLKLLADFRKPEKMAKLPVILGNLDVTID
NVSPDFPNYVNSSYIPMKQFENSTKTLTAFEIEEFVPCIPKCTQPFTIYNNHLYVYPKHL
KYDSQKSFAKARNIAVCVEFKDSDEEDSLPLKCIYGRPGGPVFTRSAFAAVLHHHQNPEF
YDEIKIELPTQLHEKHHLLFTFYHVSCDNSSKGSTKKKDVVETQVGYSWLPLIKDGRVVT
NEQQIPVSANLPSGYLSYQEVGVGKHSGPEIKWVDGGKQLLKISTHLVSTVYTQDQHLHN
FFQYCQKTESGARALGTDLVKYLKSLHAMEGHVMIAFLPTVLNQLFRVLTRATQEEVAVN
VTRVIIHIVAQCHEEGLDSYLRSYVKYAYKAEPYVASEYKTVHEELTKSMTTILKPSADF
LTSNKLLKYSWFFFEVLIKSMAQHLIENSKVKLLRNQRFSASFHHAVETVVNMLMPHITQ
KYRDNPEASKNANHSLAAFIKRCFTFMDRGFVFKQINNYISCFAPGDPKALFEFKFEFLR
VVCNHEHYIPLNLPMPFGKGRVQRYQDLQLDYSLTDEFCKNHFLVGLLLREVGNALQEFR
DVRQIAISVLKNLMIKHSFDDRYATRGHQARIATMYLPLFGLLIENVQRINVKDVSPFPV
NPSSNSTKDDVQILPTASQLVTPQKSGNTLDNNLPKDLFGVISGIASPYTTSTPNINSVR
NADSRGSLISTDSGNSLPERHSDKSNSLDKNQQSSTLGSSVVRYDKLDQAEIKSLLMCFL
HILRSMSDDALFTYWNKATKSELMDFFTITEVCLHQFQYMGKRYIARNQEGLGSIVHDRK
SQTLPVSRNRTGMMHARLQQLSSLDNSLTFNHSYGHSDADVLHQSLLEANIATEVCITIL
DTLSLFTMAFKTQLLTDHGHNPLMKKVFDVYLCFLQKNQSETALKNVFSALRALIYKFPS
TFYEGRADMCSALCYEILKYCNSKLSSIRNEASQLLYFLMRNNFDYTGKKSFVRTHLQVI
ISVSQLIADVVGIGGTRFQQSLSIINNCANNDRIIKHTTFPSDVKDLTKRIRTVLMATAQ
MKEHENDPEMLVDLQYSLAKSYASTPELRKTWLDSMARIHVKNGDLSEAAMCYVHVAALV
AEYLTRKVTGMFRQGCTAFRVITPNIDEEASMMEDVGMQDVHFNEDVLMELLEQCADGLW
KAERYELIADIYKLIIPIYEKRRDFERLAHLYDTLHRAYSKVTEVMHTGKRLLGTYFRVA
FFGQGFFEDEDGKEYIYKEPKLTPLSEISQRLQKLYSDKFGAENVKMIQDSGKVNPKDLD
SKYAYIQVTHVIPYFEEKELQERKTDFERTHNIRRFMFEMPFTQGGKRQGGVEEQCKRRT
ILTAIHCFPYVKKRIPVMYQHHTDLNPIEVAIDEMSKKVAELRQLCSSAEVDMIKLQLKL
QGSVSVQVNAGPLAYARAFLDDTNTKRYPDNKVKLLKEVFRQFVEACGHALGVNERLIKE
DQLEYQEEMKANYREMAKELSEIMHEQITPVEEKASVMPNSLHIFNAISGTPTSTTVHGM
PSSSSVA
Download sequence
Identical sequences H0ZL81
59729.ENSTGUP00000011354 ENSTGUP00000011354 ENSTGUP00000011354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]