SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011389 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011389
Domain Number 1 Region: 216-337
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000033
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 2 Region: 87-208
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000863
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 3 Region: 2-55
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000151
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 4 Region: 42-87
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000168
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 5 Region: 306-335,393-454
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000785
Family Growth factor receptor domain 0.0089
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000011389
Domain Number - Region: 917-1042
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00051
Family Growth factor receptor domain 0.004
Further Details:      
 
Domain Number - Region: 522-618
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0243
Family Growth factor receptor domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011389   Gene: ENSTGUG00000011028   Transcript: ENSTGUT00000011513
Sequence length 1429
Comment pep:novel chromosome:taeGut3.2.4:9:23493551:23582834:-1 gene:ENSTGUG00000011028 transcript:ENSTGUT00000011513 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LADVNECSTGNGGCHDRCCNTIGSYHCKCPAGQRLGEDGKSCADVDECEVLNGGCQQGCA
NTPGSFQCQCQPGFRLHADGRTCLAVNSCSINNGGCEQDCVQLSEDHYKCQCQPGYQLKT
DAKSCEVIDPCTSGNGGCSQICQNERGIAKCGCHPGHSLAADKKSCLDVDECAEGRARCA
HRCVNTPGSFSCACSPGFELGADGRRCYRIEMEIVDSCRDENGGCEHVCEHTAAGPRCSC
HRGHRLAGDTKTCPDVDECETGESCCSQFCINYAGGYECACKAGFQLGTDGCACDDVDEC
RLDNGNCDHFCVNSLGSYECACKEGYRLGHSRWACVALPTDLRSDFGMGIFTNPGNLGAQ
LEPSLNMARAGLRAVRGSTGKLRNAHFAFVPNRQLCLGDTFGQDCSLRCEDCLHGGRCNS
ERSGCVCPPGWAGIICNETCPPGTFGTGCAGVCGCRNGGWCDPGTGQCRCPPGVQGQLCE
DGCPKGFFGKNCNKPCNCANKGHCHRLYGACLCDPGLYGRFCHLTCPRWAFGAGCSEECQ
CVKEHTLECSPRNGSCTCQPGYHGKKCHKECTPGFYGAGCKLRCSCPPDVLCDPETGACK
HPCPSGFHGEKCHLSCQPGSFGMGCRQRCSCGGAPCDPRTGQCVCPAGKTGAACEQDCPD
GQWGPDCQNSCEPCANGGQCNRETGACDCPPGYTGPSCSATCPDGHYGQGCLWLCSCGSS
AQCHHVTGECSCPPGWTGDCKHPCSSGRWGRGCANSCACQGGDGGCDPATGTCSCQPGFT
GQHCQLRCPEGSFGPGCESSCQCQHGAACDHISGACTCTAGWTGTFCERACPDGFFGIDC
HQVCKCKNAAGCDHVLGLCHCLPGWMGESCEQPCPRGWYGANCQQRCLCHGQATCDPVSG
QCQCPQGWTGTACELACPRGWYGANCQQRCLCHGQATCDPVSGQCQCPQGWTGTACELEC
GDGQFGEGCEQNCSCHHGVCDQPSGKCLCHAGWTGDRCDVACPPGFFGQRCEERCDCAHG
WSCHPQSGACRCQSGWRGRHCDKPCPPGRYGAGCAQRCRCPATRPCHHLTGACRCPPGLT
GHGCHKTCPVGTYGQDCQGVCQCSAENQECHPVTGHCSCSPGYHGAHCHLRCPEGTYGSN
CQNPCKCMNGGHCDPASGTCDCAPGFIGANCSKTCPESWYGKDCAHLCACGKGQCDPRTG
ECSCPPGHTGPACQQVCPQGQYGPNCHLRCTCQNGGICDHVDGNCTCGLGWTGRSCEEEC
LPGKYGAGCSLDCSCQHNGTCDRFTGCCRCPEGFYGHSCEHGCPLGFYGLGCLQACACKN
GASCDAVTGQCLCPLGYHGVHCEKGCARGWFGEGCQHQCDCGDAPCDPETGKCLCPPGKT
GDKCDIGCRADRYGPGCSLRCQCAGRSRCDPRNGRCACPSPGMGPTCRE
Download sequence
Identical sequences H0ZLB6
ENSTGUP00000011389 59729.ENSTGUP00000011389 ENSTGUP00000011389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]