SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011423 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011423
Domain Number 1 Region: 516-753
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.66e-43
Family DBL homology domain (DH-domain) 0.00041
Further Details:      
 
Domain Number 2 Region: 223-367
Classification Level Classification E-value
Superfamily PH domain-like 8.3e-42
Family Third domain of FERM 0.00023
Further Details:      
 
Domain Number 3 Region: 880-1029
Classification Level Classification E-value
Superfamily PH domain-like 4.56e-33
Family Pleckstrin-homology domain (PH domain) 0.0029
Further Details:      
 
Domain Number 4 Region: 123-225
Classification Level Classification E-value
Superfamily Second domain of FERM 4.71e-27
Family Second domain of FERM 0.0000953
Further Details:      
 
Domain Number 5 Region: 738-861
Classification Level Classification E-value
Superfamily PH domain-like 8.48e-26
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Domain Number 6 Region: 42-122
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.2e-22
Family First domain of FERM 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011423   Gene: ENSTGUG00000011061   Transcript: ENSTGUT00000011547
Sequence length 1046
Comment pep:known chromosome:taeGut3.2.4:1:40149532:40314726:-1 gene:ENSTGUG00000011061 transcript:ENSTGUT00000011547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGETEQRPTAGSRLGAQENAGISTLEHGQKPPMTTPGKLVSIKIQMLDDTQETFDIPQRA
PGKVLHDAVCNHLNLVEGDYFGLEFPDHKKMMVWLDLLKPVMKQIRRPKHVVVKFVVKFF
PPDHAQLQEELTRYLFALQVKQDLAQGRLTCNDTSTALLISHIVQSEIGDFDETIDREHL
AKNKYIPHQEALEDKIMEFHRNHMGQTPAESDFQLLEVARRLEMYGIRLHPAKDREGTKI
NLAVANTGILVFQGHTKINAFNWAKVRKLSFKRKRFLIKLRPDVNSSFQDTLEFLMASRD
FCKSFWKICVEHHAFFRLFEEPKPKPKPVLFSRGSSFRFSGRTQKQVLDYVKEGGHKKVQ
FERKHSKIHSIRSLTAQPSEQHTEVPKQVSDFSACLPFSWKLRSPGLQSCRQGKELKSST
EDTGQHKSPSLKKSPKEGRKVDGAVVSTVEEEEEPAKDKMQQNRPQSQQPSTGSLTGSPH
LSELSINSQGGPSVANMTLSPNLSPDAKQSSPLVSPLLNDPSCIRADDEEEVKRKRFPTE
KAYFIAKEVATTERTYLKDLEVITSWFQSAVSKEDCMPETLKNLIFSNFEPLHKFHTGFL
KEIEQRLALWEGRSNAHIKGDYQRIGDVMLKNIQSMKQLTIHLRKHNEILIELENGIKSS
RKLETFCRDFELQKVCYLPLNTFLLRPLHRLMHYKQIMERLCKHYPPSHTDFRDSRAALA
EISEMVAQLHGNMIKMENFQKLHELKKDLIGMDNLVIPGREFIRLGSLSKLSGKGLQQRM
FFLFNDILLYTSRGLTASNQFKVHGHLPLYGMTMEESEEEWGVPHCLTLRGQHQSIVVAA
STRAEMDKWTEDIQMAIDLAEKSSGPVPELLASSPPDNKSPDETTVDQESEDDLSASRTS
LERQSPHRGNTTVHVCWHRNTSVSMIDFSIAVENQLSGNLLRKFKNSNGWQKLWVVFTNF
CMFFYKSHQDNHPLASLPLLGYSLTLPTESENIHKDYVFKLHFKSHVYYFRAESEYTFER
WMEVIRSATSSASRTRALSHKEPHAY
Download sequence
Identical sequences H0ZLF0
ENSTGUP00000011423 ENSTGUP00000011423 59729.ENSTGUP00000011423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]