SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011431 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011431
Domain Number 1 Region: 321-536
Classification Level Classification E-value
Superfamily L domain-like 2.04e-36
Family Ngr ectodomain-like 0.0046
Further Details:      
 
Domain Number 2 Region: 19-224
Classification Level Classification E-value
Superfamily L domain-like 1.45e-32
Family Ngr ectodomain-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011431   Gene: ENSTGUG00000011091   Transcript: ENSTGUT00000011555
Sequence length 540
Comment pep:known_by_projection chromosome:taeGut3.2.4:9:24530127:24531791:1 gene:ENSTGUG00000011091 transcript:ENSTGUT00000011555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HIHCDNKGFINISQITESWSRPFKLYLQRNSMRKLYTNSFLHLNNAVSINLGNNALQDIQ
TGAFNGLRVLKRLYLHENKLDIFRNDTFLGLESLEYLQADYNVIKRIESGAFRNLSKLRV
LILNDNLIPMLPTNLFKSVSLTHLDLRGNRLKVLSYRGMLDHIGRSLMEIQLEENPWNCT
CEIVQLKSWLERIPYTALVGDITCETPFHFHGKDLREIKRSKLCPMLSDSENAWPTKPSS
MLSSFHFTASSVEYKTSNKQPKPTKQPRAPRPPPTPRGLYPGPNQPPVAAYQTRPPIPII
CPTGCSCSLHINDLGLTVNCKERGFHNISELLPRPLNAKKLYLSGNLIQKIYRSDFWNFS
SLDLLHLGNNRISYVQDGAFINLPNLKSLYLNGNDIERLTPGMFRGLQSLHYLYFEYNLI
REIQPAAFSLMPNLKLLFLNDNLLRTLPTDAFAGTSLARLNLRNNHFLALPVAGVLEHLH
AIVQIDLKLNPWDCTCELVPLKQWLEALSSVSVVGEVLCASPEPLARRDLRSLELAALCP
Download sequence
Identical sequences H0ZLF8
ENSTGUP00000011431 59729.ENSTGUP00000011431 ENSTGUP00000011431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]