SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011467 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011467
Domain Number 1 Region: 176-269
Classification Level Classification E-value
Superfamily NSFL1 (p97 ATPase) cofactor p47, SEP domain 6.67e-33
Family NSFL1 (p97 ATPase) cofactor p47, SEP domain 0.0000104
Further Details:      
 
Domain Number 2 Region: 253-366
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.9e-29
Family UBX domain 0.0000504
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011467   Gene: ENSTGUG00000011120   Transcript: ENSTGUT00000011591
Sequence length 369
Comment pep:novel chromosome:taeGut3.2.4:2:118071176:118083117:1 gene:ENSTGUG00000011120 transcript:ENSTGUT00000011591 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADGGAAPAQPDGDVPAAPAAGGRRDRQPRSSGRPPSARDLQLALAELYEDEAKRQSLCS
DKPTATKISNPKVSQSLKLDSLKRLRKPERSMSDDKENQRFYSGDSEYKGLQISGASNNP
SKIVAELFKEAKEHGAVPLDEASRASGDFSKAKSFSGGGYRLGDSSQKHSEYIYGENQDV
QILLKLWRNGFSLDDGELRSYSDPTNAQFLESVKRGEIPLELQRLVHGGQVNLDMEDHQE
QEYVKPRLRFKAFSGEGQKLGSLTPEIVSTPSSPEEEEKSILNAPVLIDDSMPATKIQIR
LADGSRLIQRFNQTHRIKHIRDFIIQSRPAFATTDFVLVTTFPNKELTDESLTLQEADIL
NTVILQQLK
Download sequence
Identical sequences H0ZLJ4
59729.ENSTGUP00000011467 XP_012427417.1.42559 ENSTGUP00000011467 ENSTGUP00000011467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]