SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011476 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011476
Domain Number 1 Region: 332-508,543-709
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.08e-83
Family YicI catalytic domain-like 0.00048
Further Details:      
 
Domain Number 2 Region: 1201-1398,1442-1603
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.62e-75
Family YicI catalytic domain-like 0.00027
Further Details:      
 
Domain Number 3 Region: 87-331
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.88e-48
Family YicI N-terminal domain-like 0.0066
Further Details:      
 
Domain Number 4 Region: 953-1198
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.07e-44
Family YicI N-terminal domain-like 0.0081
Further Details:      
 
Domain Number 5 Region: 1606-1686
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 7.91e-18
Family Putative glucosidase YicI, domain 3 0.0089
Further Details:      
 
Domain Number 6 Region: 712-792
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.29e-16
Family Putative glucosidase YicI, domain 3 0.011
Further Details:      
 
Domain Number 7 Region: 926-974
Classification Level Classification E-value
Superfamily Trefoil 0.000000000785
Family Trefoil 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011476   Gene: ENSTGUG00000011092   Transcript: ENSTGUT00000011601
Sequence length 1733
Comment pep:known chromosome:taeGut3.2.4:9:24577628:24616327:1 gene:ENSTGUG00000011092 transcript:ENSTGUT00000011601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRKFSGLELTLIALFTVVTVIACSFLRVIQSELPDTDAINGMSQDPGINHSFISLTDSD
FHPQCPNTPVAERIDCIPDQLATQSTCSLRGCCWSPQNDASVPWCFFSPSHGYQVQGSQR
STQAGFEATLERLPAPSLFGDDIQTVLLTAEYQTKNRFRFKITDPNAQRFEVPHEHVKPF
KGSAASSPSYKVELKQNPFGLVVTRASNGRVLFDTTIGPLQYADQFLQLSIKLPSSNIYG
VGEHVHKQYRHDVNWKTWPIFGRDTAPSAAMDNLYGAHTFFLCLEDNTGASFGVFLMNSN
AMEFVVQPAPAVTYRTIGGILDFYIFLGNTPEQVVQEYLQLVGLPALPAYWNLGFQLCRY
GYTSLEEVKTVVERNRAVGLPHDIQVIDIDYMENRKDFTYDKVKFNGLPQFADYLHKHGQ
KYIIILDPAISTQKRADQSPYGSYVRGTEKNVWVNESDGTALVGEVWPGETVFPDYTSLE
ATNWWVNECEMFYKEVPYDGIWIDMNEVCNFVQGSKKGCAENKLNYPPYTPRILDKVMYS
KTLCLDAVQSWGKQYDVHNLYGYSMTLSTRKAIETVFPGKRSFLISRSTFAGSGKHGGHW
LGDNAATWDQLRWAIPGMLEFNLFGIPYVGADICGFTENTTEELCRRWMQVGAFYPFSRN
HNAEFVIHQDPAVFGPNSLLVNSSKHYLNIRYTLLPYLYTLHYKAHTRGDTVVRPLLHEF
YSDEITWDIDRQFLWGPGLLISPALEPGVESTSVYFPDAEWYEYDTGEPMQLKKVWHNIP
TPGDKMGLHLRGGYIFPTQKPNTTTVASRKNPMGLIIALDINNEASGDLFWDDGESTGTI
DKKTYIYYEFKVSNNALQMTATHSNYADPNKLKFEEIKILGLSKEIGSVSVFQNNVLQNY
VSDTTYDPLTKVAVIKGLQLDLGKSYTIKWTQNTNINERFNCHPGPNATKEKCEQLGCSW
ETANPDVPSCYYSSSNPYLIKNFNYSSTGIVANLSLDDFRVRANDAYTAPIGTLRLEVKY
HLNNMLQFKIYDYQNPRYEVPVPLNLPSSPTSSDMERLYDVSLQIKPFGIQVRRKSTGTV
IWNSGLPTFTFSDMFIQISTRLASQYIYGFGESEHPTFRHNMSWHTWGMFTRDQPPTYKL
NSYGVHPFYMALEEDGNAHGVLLLNSNAMDVTFQPTPALTYRTIGGVLDFYMFLGPTPEL
VVQEYTQLIGRPFMPPYWSLGFQLCRYGYGNDSDVAKVVEDMKAAQIPHDVQYVDIDYMD
RNLDFTLSPRFAGLPALINKIKSEGMRFIIILDPAISGNETDYPAFTRGVANNIFVQWPD
TKEILYSKVWSFLPNVQIDESLPHEELVEKYVSHCAFPDFFRNSTVEWYKREILEVYNNA
NASISLKFDGLWTDMNEPAAFMNGAMGGCRNNLLNYPPYMPHLGYRSTGLIHKTPCMEGL
HYLPDGTPARHYDVHSLYGWSQGRPSLEALQGATKERGVVISRSTYPSSGRWVGHWLGDN
TAAWDQLHKSIIGMMEFSLFGISYTGADICGFFKDAQYEMCIRWMQLGAFYPYSRNHNEK
GTRRQDPASWDEEFKNMSRKVLNTRYTLLPYLYTLLYNAHAHGSTVVRPILHEFVGDRTT
WDIDKQFLWGPALLISPVMKENDRSVVAYFPDARWYDYHTNSDTGFRKKFQNLSAPLDHI
NLHIRGGHILPWQRPATRTAYSRKNPMGLTVALDDDLLAEGQLYWDDGVRIST
Download sequence
Identical sequences H0ZLK3
ENSTGUP00000011476 59729.ENSTGUP00000011476 ENSTGUP00000011476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]