SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011493 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011493
Domain Number 1 Region: 204-270
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000227
Family Ras-binding domain, RBD 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011493   Gene: ENSTGUG00000011147   Transcript: ENSTGUT00000011618
Sequence length 338
Comment pep:known_by_projection chromosome:taeGut3.2.4:7:27601756:27613073:-1 gene:ENSTGUG00000011147 transcript:ENSTGUT00000011618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTMKAQHLPSVFINEEKFVTREQLSSLLKNYNSYYSDQENLQLTYNQREGSTPFIEGILS
IFWGVRHPIRLKIQDEKQIPSFVTLKSTENVGVFPSKRGMTRWGEFDDLHHISGDTLKST
EEQPDLQPSYPCYESHTLQSRREPELNCATLPRTSSDATVVRRRTKLPTITRTEVETHRF
SINGHFYNHETSVFTPAFGSETKIRINSQMRTRQVIEQLLRKFKIENSPHEFALYVIHAS
GEKKQLRSRDVPLLHRLLQGPSEKVAKFFLMDGDVEEISSDVAQYISFHLPFLESILHRI
NEEEEQEIQQTTARYVREKRLIQQHLRSRGVKKTETTV
Download sequence
Identical sequences H0ZLM0
ENSTGUP00000011493 59729.ENSTGUP00000011493 ENSTGUP00000011493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]