SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011545 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011545
Domain Number 1 Region: 127-368
Classification Level Classification E-value
Superfamily vWA-like 1.37e-84
Family Integrin A (or I) domain 0.000000298
Further Details:      
 
Domain Number 2 Region: 374-454
Classification Level Classification E-value
Superfamily Integrin domains 3.4e-21
Family Integrin domains 0.00093
Further Details:      
 
Domain Number 3 Region: 622-703
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.05e-16
Family Integrin beta tail domain 0.0031
Further Details:      
 
Domain Number 4 Region: 26-83
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000011
Family Plexin repeat 0.0018
Further Details:      
 
Domain Number 5 Region: 537-577
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000642
Family Integrin beta EGF-like domains 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000011545
Domain Number - Region: 502-530
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00391
Family Integrin beta EGF-like domains 0.019
Further Details:      
 
Domain Number - Region: 459-486
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00558
Family Integrin beta EGF-like domains 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011545   Gene: ENSTGUG00000011172   Transcript: ENSTGUT00000011670
Sequence length 773
Comment pep:known_by_projection chromosome:taeGut3.2.4:7:28409868:28415930:1 gene:ENSTGUG00000011172 transcript:ENSTGUT00000011670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRDCCLQLPAVTWVLLLVTTAFTMECPKIKVGTCKDCIQSGPGCAWCKKLNFTKAGEPD
AVRCDTIEQLKKRGCPDTEIEFPGNEIKSTQNNPLSHETQLTPQEMHLKLRIGHPAAFEV
KFRRAMGYPIDLYYLMDLSYSMLDDLENVKKLGGELLRALESTTPSRRIGFGSFVDKTVL
PFVNTHPEKLQNPCPNKDTKCQPPFAFKHILSLTDNAEQFESEVGKQFISGNLDAPEGGL
DAMMQAAVCGDQIGWRNVTRLLVFATDDGFHFAGDGKLAGILTPNDGKCHLEDNMYKRSN
EFDYPSVGQLVQKLAENNIQPIFAVTSKVVDVYKKLSEMIPKSAVGELNQDSSNIIELIQ
VAYNNLSSRIILDHSTLLDTLDVKYDSKCKNDKDSVDEARGQCDNVKINEEVIFKVKVTA
KACIPKYSFTIRPLGFTDTLTVHVTSNCDCHCNDKPDPTACNGQGIIECGTCSCNSRYTG
KNCECDTKGKTSKELEHSCRRDNSSVICSGQGDCVCGQCVCHTSDVPGKYIYGTYCQCDN
KNCEFFNGSLCGGPARGQCDCGACKCLPGYEGSACQCQQSTESCLNARRHVCSLRGTCHC
NRCQCSGGYQPPFRKCPGCPSPCGRYISCVECKFFNSGPFEKNCSQACLNIQLPTNSTEV
STSDRKCREKDSQNCWMSFHMVQEDGEEIYTIIVDPDRECPQPPNVPLIVGSTIAGVFLI
GILVLVIWRLLMELLDRREYRRFEKEKSKAKWNDADNPLFKSATTTVVNPKFN
Download sequence
Identical sequences H0ZLS2
ENSTGUP00000011545 ENSTGUP00000011545 59729.ENSTGUP00000011545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]