SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011560 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011560
Domain Number 1 Region: 1191-1489
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.06e-66
Family Tandem AAA-ATPase domain 0.000043
Further Details:      
 
Domain Number 2 Region: 918-1189
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.86e-56
Family Tandem AAA-ATPase domain 0.0000647
Further Details:      
 
Domain Number 3 Region: 2630-2713
Classification Level Classification E-value
Superfamily BRK domain-like 1.01e-27
Family BRK domain-like 0.00000443
Further Details:      
 
Domain Number 4 Region: 2560-2635
Classification Level Classification E-value
Superfamily BRK domain-like 8.63e-17
Family BRK domain-like 0.0000579
Further Details:      
 
Domain Number 5 Region: 876-937
Classification Level Classification E-value
Superfamily Chromo domain-like 0.000000000000486
Family Chromo domain 0.0036
Further Details:      
 
Domain Number 6 Region: 785-865
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00000000000751
Family Chromo domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011560   Gene: ENSTGUG00000011196   Transcript: ENSTGUT00000011685
Sequence length 3010
Comment pep:known_by_projection chromosome:taeGut3.2.4:2:119025473:119114909:1 gene:ENSTGUG00000011196 transcript:ENSTGUT00000011685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADPGMMSLFGEDGNIFSEGLEGLGECGYPENTVNPMGQQMPMDQGFPTLQSSLHHPPAN
QNQAKLTHFDHYNQYEQQKMHLMDQPNRMISNAPGNGIASPHSQYHNPPVPQVPHSSGAG
GQMGVYPGMQNERHGQPFVDSGSMWGPRAVQVPDQIRAPYQQQQQQQQPQPTQPPQAPSG
PPGQGHPQHMQQMGNYMARGDFSMQQHGQPQQQRMNQFSQGQEGLNQGNPFIATSGPGHL
SHVPQQNPSMAPSLRHSVQQFHHHPPAALHGESVAHSPRFSPNPPQQGAVRPQTLNFSSR
SQTVPSPTINNSGQYSRYPYSNLNQGLVNNTGMNQNLGLTNNTPMNQSVPRYPNAVGFPS
NSGQGLMHQQPIHPSGSLNQMNTQTMHPSQPQGTYASPPPMSPMKAMSNPAGTPPPQVRP
GSAGIPMEVGSYPNIPHPQPSHQPPGAMGIGQRNMGPRNMQQNRPFMGMSSTPREMGGHM
RPNGCPGVGLADPQAIQERLISGQQLPSQQQSFQQQMPTCPPMQPHPGIHHQSSPPPHPH
HQPWAQLHQSPQNTPQKVPVLQHSPSEPFLEKPVPDMTQVSGPNTQLVKSDDYLPSIEPQ
PQQKKKKKKNNHIAAEGPSKGFGKEDFPGGLDSQNLSRNSVDCSQEDKKKKKKPKAKKEP
KDPKEPKEKKEPKTPKVPKTPKEPKEKKAKNTTPKPKTSKKASSKKQDSEASAAKKKVKG
KEGSENSDLEKTPPPSPHPEDEDDPGVQKRRSSRQVKRKRYTEDLEFKISDEEADDADAA
GRDSPSNTSQSEQQESADAEGPIVEKIMSSRLVKKKMENGEEVEVEEFYVKYKNFSYLHC
QWASVEELDKDKRIQQKIKRFKAKQGQNKFLSEIDDELFNPDYVEVDRIMDFSRSTDDNG
EPVTHYLVKWCSLPYEDSTWELKQDIDQAKIEEFEKLMSREPEMERVERPPADDWKKSES
SREYKNNNKLREYQLEGVNWLLFNWYNTRNCILADEMGLGKTIQSITFLYEIYLKGIHGP
FLVIAPLSTIPNWEREFRTWTELNVVVYHGSQASRRTIQLYEMYFKDPQGRVIKGSYKFH
AIITTFEMILTDCPELRNIPWRCVVIDEAHRLKNRNCKLLEGLKMMDLKHVLLTGTPLQN
TVELFSLLHFLETGRFPSETTFMQEFGDLKTEEQVQKLQAILKPMMLRRLKEDVEKNLAP
KEETIIEVELTNIQKKYYRAILEKNFAFLSKGGGQANVPNLLNTMMELRKCCNHPYLING
AEEKILEEFKETHNADSPDFQLQAMIQAAGKLVLIDKLLPKLKAGGHRVLIFSQMVRCLD
ILEDYLIQRRYPYERIDGRVRGNLRQAAIDRFSRPDSDRFVFLLCTRAGGLGINLTAADT
CIIFDSDWNPQNDLQAQARCHRIGQSKSVKIYRLITRNSYEREMFDKASLKLGLDKAVLQ
SMSGRENSTNGVQQLSKKEIEDLLRKGAYGALMDEEDEGSKFCEEDIDQILLRRTHTITI
ESEGKGSTFAKASFVASGNRTDISLDDPNFWQKWAKKAELDIDALNGRNNLVIDTPRVRK
QTRLYSAVKEDELMEFSDLESDSEEKPSTKPRRPQDKSQGYARSECFRVEKNLLVYGWGR
WTDILSHGRYKRQLTEQDVETICRTILVYCLNHYKGDENIKSFIWDLITPTADGQTRALV
NHSGLSAPVPRGRKGKKVKAQSSQPMLQDADWLTTCNPDVLFQEDSYRKHLKHHCNKVLL
RVRMLYYLRQEVIGDQADKILEGADSSEVDVWIPEPFHAEVPADWWDKEADKSLLIGVFK
HGYEKYNSMRADAALCFLERVGMPDAKAIAAEQRGTDMLADGGDGGEFDREDEDPEYKPT
RTPFKDEIDEFANSPPEDKEESIELHPSKHSESNAELGQLYWPNTSTLTTRLRRLITAYQ
RSYKRQQMRQEALMKTDRRRRRPREEVRALEAEREAIITEKRQKWTRREEADFYRVVSTF
GVIFDPVKHQFEWNQFRAFARLDKKSDESLEKYFNGFVNMCRRVCRMPVKPDDEPPDLST
LIEPITEERASRTLYRIELLRKIREQVLHHPQLGERLKLCQPSLDLPEWWECGKHDKDLL
IGASKHGVSRTDYHILNDPELSFLEAHKNFAQNRGTGNANIVSSVNPLGAGCSQTPPVVP
STPVPEEKTTEQTESKVEGSENPAAKEKSEIKEETDTTDKDTKPDCDAEAEPGSVKCELK
DIEMNTDVDPKSISEKGSEEDEEEKLEDDDKSEESSQPEAGAVSQGKNFDEESNASMSTA
RDETRDGFYMEDGDPSVVQLLHERTFAFSFWPKDRVMINRLDNICEAVLKGKWPVNRRQM
FDFQGLIPGYTPTAVDSPLQKRSFAELSMVGQASISGSEDLTASPHFADEDALNLSVPRQ
RRRRRRKIEIEAERAAKRRNLMEMVAQLRESQVVSENGQEKVVDLSKASREATSSTSNFS
SVTSKFILPNVSTPVSDAFKTQMELLQAGLSRTPTRHLLNGSLIDGEPPMKRRRGRRKNV
EGLDLLFMSNKRTSLTVEDAEVTKAFEEDMEALPARNIPSPGQLDPDTRIPVINLEDGTR
LVGEDAPKNKDLVEWLKLHPTYTVDMPSYVPKSADVLFSPFQKPKQKRHRCRNPNKLDIN
TLTGEERVPVVNKRNGKKMGGAMAPPMKDLPRWLEENPEFAVAPDWTDIVKQSGFVPESM
FDRLLTGPVVREEGASRRGRRPKSEIAKAAAAAAAVASTSGINPLLMNSLFAGMDLTSLQ
NLQNLQSLQLAGLMGFPPGLATAAAAGGDAKNPAAMLPLMLPGMAGLPNMFGLSGLLNNP
ITATTGNATTASGQGETEDGASKAEEKKNENEEENKDSEKSTDTVSATDSANGSVSAATA
ATTATTTTTTTTNTGLPTNPLAFNPFLLSTMAPGLFYPSMFLPPGLGGLTLPGFPALAGL
QNAVGSNEEKATDKTEGAAFKDEENLEGSDAEESLDKTADSSVLEDEIAQGEELDSLDGG
EEIENNENDE
Download sequence
Identical sequences H0ZLT7
ENSTGUP00000011560 ENSTGUP00000011560 59729.ENSTGUP00000011560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]